Entry information : PpePrx57 (ppa019253m)
Entry ID 9297
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx57 (ppa019253m)
Name (synonym) PpePrx57 (ppa019253m)
Class Class III peroxidase    [Orthogroup: Prx201]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx57
start..stop
S start..stop
PpePrx53 652 0 1..330 1..329
PpePrx55 588 0 1..330 1..330
PpePrx54 455 1e-162 1..330 1..322
PpePrx43 451 5e-161 13..330 7..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1965964..1966200 237 N° 2 1965392..1965586 195 N° 3 1963837..1964397 561  
complement(join(1963837..1964397,1965392..1965586,1965964..1966200))


exon

Literature and cross-references PpePrx57 (ppa019253m)
DNA ref. Phytozome 12:   scaffold_6 (1966200..1963837)
Protein sequence: PpePrx57 (ppa019253m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (308)
PWM (Da):   %s   35871.72 (33518.5) Transmb domain:   %s   o10-32i
PI (pH):   %s   4.77 (4.68) Peptide Signal:   %s   cut: 33 range:23-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAANSHQPVLVLFTTFVVAAAIVLAPTTCTAQLTCDFYQQSCPQALQIIRSVVNEAINRERRMGASLLRLHFHDCFVNGCDGSILLDDTVNFTGEKTAGANLNSVRGFDVIDEIKATLNTYCNGNVVSCADILAVAARDSVEILGGPSYSYEVQLGRRDATTAVLNDANRNIPPPTFDFSQLLSIFQSHGLGLQDLILLSGGHTIGLARCTTFRDRIYNDTNIDPEFAASLREGCPANGGDDNTTPIDSTTTQFDTVYFKSLLQKKGLFHSDQELFKSDGSDSDNLVQHYANSPEDFKVDFGASMIKMGNINPLTGYAGEIRLNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAGCTAATTCTCATCAACCTGTCTTGGTTTTGTTCACAACTTTTGTTGTTGCAGCTGCTATTGTGTTGGCCCCAACTACATGCACTGCTCAACTCACTTGTGATTTCTATCAG
CAGTCCTGCCCTCAGGCATTGCAAATCATCAGATCAGTTGTCAACGAAGCAATTAATCGGGAGAGGCGCATGGGAGCGTCGCTCCTACGCCTGCACTTCCATGACTGCTTTGTCAAT
GTA
GGTTTCATTTTGTGGCTTTGTTCAACATTTTATTTTATTTTAGTTTTTGGTATTTCTTGTATACAAACAAAATCATACTTTTCCACGAGGTAGCACAATATTGTTGTTGATTATGTTGAC
GGACTGTGAATATGAACCGTTAATCATATGAATACTTAGTGTTACAAAACCAAACCAAAGGTTGAGTAACTTTAGAGCGTGCAAGGTTGAGGAATAAATCTCACTTTAGAAACTGGGTTT
TTACCTAACAAGAAAGGAGATAGTTGTTTAACATAGATCGTTTTTTGAATTATTACTTACGTTCAAACAACTTTGATGAAGATTTTAGTACTGAAACATTGACTATAGTTTCAAATTTTC
CATCTTGGTGGCAGGGGTGTGATGGATCGATTTTGCTGGACGACACAGTGAACTTCACTGGTGAGAAGACGGCGGGTGCGAATCTGAACTCCGTTAGAGGTTTTGATGTAATTGATGAAA
TTAAAGCAACCCTCAATACATATTGCAATGGCAATGTGGTCTCATGTGCTGATATCTTAGCAGTTGCAGCTCGTGACTCGGTTGAGATT
GTAAGTGTTAAAAAAAGCCTTCGATGTCTAA
ATTGTCCAACAAGGATTTTTCTAGCCATTTTATTTTTAGCATGTTATGTTGTTAACTACTAACAAATGAGTGCTGTCAAACGAATTCTAAAATTAACTGAGTATACCCTACTGCCAAACT
ACTATTTATTGAATTACTAATTTACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGTACTTAGTTAATTTTAAGATTCGTTTAGCTTTTTTTTTTCCTTGATGTCCTCTGCCCAAT
GATTTCTTGCAAATTAAAGATATAATTAGAAAGGAAAGATGATTGTTGTTCAAAATTAATAGGATTATATCCATCCTCAACCAAACCTCAAATAATTAATTGTGGAAATTTTAAAATGGT
TGGTTTTTGACACGTCAAAAGTAGATTTTTTTATTGTCTCCTCTGCTTGATCTACATAGTACCATAAATTCATACATCAATTCGCTACGTGAGTCCATCAATAGTGAGGCCCTACTGTTA
ACAACTGAATACAAAATGCGTTTTGGAGTACGAGTTTCCATCTTGGATGAAAAACAACCCAATATCTTACCTTGTTATTGCCTTAGCTAAAAGAAATTTGAGATTTTTCGCACAAAATAT
TAGCCGATTTGAATTTGTTTCTTTAAATTTCAAAGGAGAACTATCAAAAGAAAAAATTTGGGTTATGGGTACGTACTGTTGGCCATTGCAGATTGTCAAAGGCAGAGAGAGTGACGCTAT
TATTTCAATGATACTAATTTACCCTAATATAAAATGATCAAAAAGTATTAGGGTGTAGCCGGGGTATTTTGGTAGTTAATTAGGGTGTATTTAGTTAATTTTACATTTTGATTTAAATAT
TATGGTGTACTTAGATTATAGGATGTACTAAGTTAATTTTAGGGTTCGTTTAACAGCACTCTAACAAATTAGCCTAATTAAAAATGGATAAATTAGTCCAACTCTTGTGCTGCTTGTGTT
TAGCTGGGAGGCCCTTCCTATTCCTATGAAGTACAATTGGGTAGAAGAGATGCAACAACTGCAGTCTTGAATGATGCAAACAGAAATATTCCTCCTCCAACTTTCGACTTCTCTCAGCTT
CTCTCCATCTTTCAATCTCATGGTCTAGGCCTGCAAGATCTGATCCTCCTCTCAGGGGGCCACACCATTGGACTAGCTAGGTGCACGACCTTCAGAGACAGGATTTACAATGACACCAAT
ATAGACCCTGAGTTTGCAGCTTCCTTGCGAGAGGGTTGTCCTGCAAATGGTGGAGACGACAACACGACGCCAATAGACTCAACCACAACGCAGTTTGATACCGTGTACTTCAAGTCTTTG
CTGCAGAAAAAAGGTCTCTTCCATTCTGATCAGGAGCTCTTTAAAAGTGATGGCAGTGATAGCGATAATCTGGTGCAGCATTACGCTAACAGCCCCGAGGATTTCAAAGTAGATTTTGGG
GCTTCCATGATCAAGATGGGTAACATAAACCCCCTCACTGGATATGCTGGTGAGATAAGGCTCAATTGCAGGAAAATCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAGCTAATTCTCATCAACCTGTCTTGGTTTTGTTCACAACTTTTGTTGTTGCAGCTGCTATTGTGTTGGCCCCAACTACATGCACTGCTCAACTCACTTGTGATTTCTATCAG
CAGTCCTGCCCTCAGGCATTGCAAATCATCAGATCAGTTGTCAACGAAGCAATTAATCGGGAGAGGCGCATGGGAGCGTCGCTCCTACGCCTGCACTTCCATGACTGCTTTGTCAAT
GGG
TGTGATGGATCGATTTTGCTGGACGACACAGTGAACTTCACTGGTGAGAAGACGGCGGGTGCGAATCTGAACTCCGTTAGAGGTTTTGATGTAATTGATGAAATTAAAGCAACCCTCAAT
ACATATTGCAATGGCAATGTGGTCTCATGTGCTGATATCTTAGCAGTTGCAGCTCGTGACTCGGTTGAGATT
CTGGGAGGCCCTTCCTATTCCTATGAAGTACAATTGGGTAGAAGAGAT
GCAACAACTGCAGTCTTGAATGATGCAAACAGAAATATTCCTCCTCCAACTTTCGACTTCTCTCAGCTTCTCTCCATCTTTCAATCTCATGGTCTAGGCCTGCAAGATCTGATCCTCCTC
TCAGGGGGCCACACCATTGGACTAGCTAGGTGCACGACCTTCAGAGACAGGATTTACAATGACACCAATATAGACCCTGAGTTTGCAGCTTCCTTGCGAGAGGGTTGTCCTGCAAATGGT
GGAGACGACAACACGACGCCAATAGACTCAACCACAACGCAGTTTGATACCGTGTACTTCAAGTCTTTGCTGCAGAAAAAAGGTCTCTTCCATTCTGATCAGGAGCTCTTTAAAAGTGAT
GGCAGTGATAGCGATAATCTGGTGCAGCATTACGCTAACAGCCCCGAGGATTTCAAAGTAGATTTTGGGGCTTCCATGATCAAGATGGGTAACATAAACCCCCTCACTGGATATGCTGGT
GAGATAAGGCTCAATTGCAGGAAAATCAACTAG

Retrieve as FASTA