Entry information : PpePrx58 (ppa020242m)
Entry ID 9298
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-16 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: PpePrx58 (ppa020242m)
Name (synonym) PpePrx58 (ppa020242m)
Class Class III peroxidase     [Orthogroup: Prx012]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx58
start..stop
S start..stop
PpePrx54 432 4e-155 1..229 1..240
PpePrx43 356 4e-125 1..229 1..238
PtPrx39 330 7e-115 1..229 1..236
CsaPrx10 310 5e-107 10..229 9..238
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1982202..1982424 223 N° 2 1982546..1982722 177 N° 3 1982936..1983226 291  
join(1982202..1982424,1982546..1982722,1982936..1983226)


exon

Literature and cross-references PpePrx58 (ppa020242m)
DNA ref. Phytozome 12:   scaffold_6 (1982202..1983226)
Protein sequence: PpePrx58 (ppa020242m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229 (211)
PWM (Da):   %s   24792.51 (22916.5) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.39 (9.36) Peptide Signal:   %s   cut: 19 range:19-229
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALRSFLAIICFVVVAATSMMPTSAKLSSGFYNKVCPQALPAIRKVVKRAISHEPRTGASLLRLHFHDCFVNGCDGSVLLDDTANFIGEKTAFPNLNSIRGFNVMDDIKKAVDKACYKSVVSCADISCCSSLGGPDYKVQLGRRDARNANRNLPPQFFSFSQLLSNFQAHGLNLKDLVVFSAAHTIGLARCTTFRARIYNDTNIDPKFAASAKYNCPTTGGDNNTRPL

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTTCGATCTTTCCTCGCGATCATCTGTTTTGTAGTGGTAGCTGCCACTAGTATATNNATGATGCCAACATCTGCAAAACTAAGTTCTGGTTTCTACAACAAAGTGTGCCCT
CAGGCACTGCCAGCTATCAGAAAAGTCGTCAAACGGGCCATCAGCCATGAGCCACGCACCGGAGCCTCTCTACTTCGCCTTCATTTCCATGACTGCTTTGTTA
ATGTAATTAAGCTTATA
TATATTGATTGTGCATGCATATAGTGCACTTGAAATAGTTGTTCATGTAAATGATCAGTTCTAATTTTTTTTTTCCTGATATGTGTTCATGGTTGAATTGATACAGGGTTGCGATGGATC
AGTTCTGCTTGATGATACTGCCAACTTCATCGGTGAGAAGACCGCCTTCCCAAATCTGAATTCGATCCGGGGATTCAACGTGATGGATGATATCAAAAAAGCTGTCGACAAAGCTTGCTA
CAAGAGTGTGGTCTCATGTGCAGATATTAGCTGTTGCAGCT
CGTGATTCTGTATCCATTGTGAGTACATACATGTTTGCTAATATTGCTAGGTTCATCAGATGTGTTCACCAAATATTGT
CCCAGTATACGTTCCATTTTCATACTAAACCCTAATATTCATTTGGCGGACAAATTTGGTGATGCTAACAGTACTCATTTTCTTTAGACATGGAATGAAATGTTTTTATTAATGAAATTT
TGTATTTGTGTTTTAGTTGGGAGGACCTGATTACAAAGTACAATTAGGAAGAAGGGATGCAAGAAATGCAAACAGAAATCTTCCACCCCAATTCTTCAGCTTCTCACAGCTTCTCTCTAA
CTTCCAAGCTCATGGACTTAACCTGAAAGACTTGGTTGTGTTCTCAGCTGCCCACACCATTGGACTTGCTCGGTGCACCACCTTCCGTGCCAGGATTTACAATGATACCAACATAGACCC
CAAGTTTGCAGCCTCTGCAAAATACAATTGTCCAACAACTGGAGGAGATAACAACACAAGGCCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTTCGATCTTTCCTCGCGATCATCTGTTTTGTAGTGGTAGCTGCCACTAGTATATNNATGATGCCAACATCTGCAAAACTAAGTTCTGGTTTCTACAACAAAGTGTGCCCT
CAGGCACTGCCAGCTATCAGAAAAGTCGTCAAACGGGCCATCAGCCATGAGCCACGCACCGGAGCCTCTCTACTTCGCCTTCATTTCCATGACTGCTTTGTTA
AGGGTTGCGATGGATCA
GTTCTGCTTGATGATACTGCCAACTTCATCGGTGAGAAGACCGCCTTCCCAAATCTGAATTCGATCCGGGGATTCAACGTGATGGATGATATCAAAAAAGCTGTCGACAAAGCTTGCTAC
AAGAGTGTGGTCTCATGTGCAGATATTAGCTGTTGCAGCT
AGTTGGGAGGACCTGATTACAAAGTACAATTAGGAAGAAGGGATGCAAGAAATGCAAACAGAAATCTTCCACCCCAATTC
TTCAGCTTCTCACAGCTTCTCTCTAACTTCCAAGCTCATGGACTTAACCTGAAAGACTTGGTTGTGTTCTCAGCTGCCCACACCATTGGACTTGCTCGGTGCACCACCTTCCGTGCCAGG
ATTTACAATGATACCAACATAGACCCCAAGTTTGCAGCCTCTGCAAAATACAATTGTCCAACAACTGGAGGAGATAACAACACAAGGCCAC

Retrieve as FASTA