Entry information : AtPrx12 (At1g71695 / PER12 / Atp4a / AtP4 / Atprxr6ge)
Entry ID 93
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx12 (At1g71695 / PER12 / Atp4a / AtP4 / Atprxr6ge)
Name (synonym) AtPrx12 (At1g71695 / PER12 / Atp4a / AtP4 / Atprxr6ge)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Flower buds
Flowers
Green siliques
Hypocotyls
Leaves
Mixed tissues
Roots
Seedling shoots
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx12
start..stop
S start..stop
AhalPrx49 719 0 1..358 1..358
AlyPrx12 707 0 1..358 1..359
CrubPrx12 704 0 1..358 1..358
BstrPrx46 688 0 1..358 1..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26964359..26964625 267 N° 2 26965591..26965785 195 N° 3 26965943..26966557 615  
join(26964359..26964625,26965591..26965785,26965943..26966557)


exon

Literature and cross-references AtPrx12 (At1g71695 / PER12 / Atp4a / AtP4 / Atprxr6ge)
Protein ref. UniProtKB:   Q96520
DNA ref. Phytozome 12:   Chr1 (26964359..26966557)
mRNA ref. GenBank:   NM_105826
Cluster/Prediction ref. Phytozome Gene 12:   19649080 UniGene:   At.94
Omic ref. AtProteome:   At1g71695 ATTED-II:   At1g71695 e-FP Browser:   At1g71695 ePlant:   At1g71695 Genevestigator:   At1g71695 RnR:   At1g71695 TAIR:   At1g71695
Protein sequence: AtPrx12 (At1g71695 / PER12 / Atp4a / AtP4 / Atprxr6ge)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (327)
PWM (Da):   %s   39421.14 (35983.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.39 (8.20) Peptide Signal:   %s   cut: 32 range:32-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKAYSTRVLTFLILISLMAVTLNLFPTVEAKKRSRDAPIVKGLSWNFYQKACPKVENIIRKELKKVFKRDIGLAAAILRIHFHDCFVQGCEASVLLAGSASGPGEQSSIPNLTLRQQAFVVINNLRALVQKKCGQVVSCSDILALAARDSVVLSGGPDYAVPLGRRDSLAFASQETTLNNLPPPFFNASQLIADFANRNLNITDLVALSGGHTIGIAHCPSFTDRLYPNQDPTMNQFFANSLKRTCPTANSSNTQVNDIRSPDVFDNKYYVDLMNRQGLFTSDQDLFVDKRTRGIVESFAIDQQLFFDYFTVAMIKMGQMSVLTGTQGEIRSNCSARNTQSFMSVLEEGIEEAISMI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2), 10 cDNA and 45 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGAATTTATA GATGTAATCA AAGACCATGA TAGTTCGATC ATTGTACATT TTGCATGCCT GGAGCCATTA TCCTTGATCA TTACGTACCA AAACATTCGG AGACATCCCA TAGATTTAAA  ACGATACAAA AAATGGTAAT TTCTTTTCCA CTTTCCACGA AACTCTTAGC TTAACTCCTT GTTTTTATAA ATCGTTCAAA ATACGTTCAT CATAAACATA GAGAAAAAAG GACGTGATGC  GAGTTTTATG AAACTAGTCC CATTAAATGT CTGCCCACAC CCCTAATTTC TGCAAACCTA AATAAGTTTA TAGTGTTACT TAGTCATCTG TTCCTAGAGT AATCATGTGG AGGTAAATGA  TTTATAACCA TATATTAATT GTTTTAACCC AAAAAAATAG AGAGTTACAT ATACTATTTT TCCAGCGTGT ATCCACATCA TATGCATCAA TATAATTTTT TTAATCAAAT TATTAATGTT  GTCCGAAGTA TTAGAAATTA TGCACAAACA TTAAATGAAT TGAAAGAAAA TAACTTAAGT TTTTTTTTGT TTAAAAATGA GATAACACAA AATGTTTCTA AAATCGGATA GAATGCGAAC  AATAACTGTT TCGGAAGTCC ATGGTAATCT ATACATGTTT TGACTACAAT ATATGTTATA AATATACGTA TTTTTAATAT ATATATATAT ATATATATAT ACGTATTTTT AGTATGTATA  TGTATATATA TATATATATA TATATAATTT GTGAAATGTC TTGTTATATA GAAAACAAAC TTATTTTCGT CCAAAATTAT TTTTTCACAG CAGTTCATAC ACATTTATGG GCATGTACTA  GTTTTTCCGA CTATAAGCAA AATTTATGTC GATTTTTCTG GATGTAACGT ATATCTTAGG AAAGAGTAAG CATATGAACG TGGCTGAAAC AAACTAAAAG TGTCTATCTA CACATACAGA  TGCTAGCCTC TATGAAACAC ACTTGTTTGG TCATTGGTGG TGGCTACTCT CACGTGCTCG CTTTGCATTA GTTTAGTTTT TTTCAAACTT CAAAAGTCTT TTATCCTTTT TGGTTATTTC  AAATGTCCCC ACCATTTCTG CAAAGTCACA ATCTTCATAA ACCATTTACG ATCCTCTACT GACTCAGCGA ATATGCCAAC ACAAGGGCGC GTGATTGTCT TGAGATTCTT CCACTGCTAT  GCGAGTTTCT TCAAAAATTC CTCATCGATC GACGCACTTA CCTTTTTTTT TAAATGGATC AAATTGTTTT TGCATCTTAG ACCAATAAAA CCATATTGTA TATATTACGT AAACATAATC  ACTAGTCCAT GATACTATTT ATGAAAGGTC ATAAAGAATC CTCTCTAAGC ATGGAACATA TGCAATTCGA ATTCGGGTTC AGAAGCACTA AAACAATACT CTTTTTAACC GGTTAAGTAT  TTGAAATAGT GCACACAAAA ATAACTAAAA AGTTTCGTGT TACTCTAATT AGTAGTAGTA CTATATATAT AACCATTGTC AATATAGTCT AACTGATATA ATAGGTGGAC CACTGTCACG  AACTTGAATG CCAGCGGGAA AAAAAAATAT ACTCGATCGC ACGTATTTAT TTGCTTTAAT GTTTGATCCG AAAAAGAATC TCTTTGGTAA GAAAAAAAGA AGCCTTTTTC TATTGACAAT  AGTAATTGGT ACGTTGAACA CAGGGTCACA GGAACGACCG AACGAGACCA GACGCAAAGC TTCCACTTGG ATATTTTTTT TCCTTTTTGA AAAGCAAAGA AATATACTCT CCTTTAATCA  CAATAAATAT ATAGAAGGAA AAGACTTCAG TATTCCTTTG CCTTTTAACA TAAGAAAAAT ATATATACTT AAAAGATAGA AATAAGACAC ACAAGGACTG AAGGACCAAA ATTGCCTATA 
AAAGCAAAGT CCATCTATTC CACAAGAACA AGAAAAGGCA GAGAAGAGAG AGGCTCTGAT AAAAAAAAAA ACAAAAAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATAACCATAA ATCTCGACCT TTCCTTTGTC AACTCTGTTT TTATTTAGTT CATGCACTTG TGGTTGGGTT GTCGAATGCG TAAAACTATC TGATAAATAA GAACGTCGCT TCATCTTAAT  TAACTTCATC CAATACCATG CACTCCTTCA TTATTTATGT GCCAATCGAG TTACTAAAAT TTAACGGGCT AAAAGAGAAT TTAAATTAGG CCCACTAGTT ACAATAACTC ACGAGGCTAT  GACCCAATAT TTGTAACTGT CTAAAGCCCA AGTTTTGGTC AACGATCTCT GACTCTCTAA TGTCCCTTCT TCCTTCCCTC CCCATTGTAC CTTTCACCTA TCCCAACAAT GGTGGAAATC  AGAAATCCCG GTATTGCTTT AACGAATCAA TCAGCAAGGA AGTGAGAACG AGAAGGAGAG ATCTGTGTTT CATTAGAGAT GAGCAAGCTC AGATTCTTCC AAAGTCTCCT AATTTCGACT  GTGATCTGCT TTTTCCTCCC GTCGATCAAC GCTAGAGGCG GCCACTCCGA CCATATCCAC CCAGGTCCGT CGCCATTTTA GTCTTCACTA TCTAATTTTT GTTCATAGCG CTTAATGAAA  ACTATTTGCA GATTTAATTA CTTACGTCAT TAATTGCTCT TAATTTGGTA ATAAGTTTAA CAATTATCTT TTTGAAGAGC ACATACTAAT TGAGGTGTAT GCATTAATTT AGTGATTTTG  TTAATCTGGT TTTATGTGTT AATTATTAGG TGATGGGAAT TATAGTTTTC ATGGTATTGT GAGGCACTTA TTTGCTCAAG AAGAGCCTAC ACCGAGGTAA TGTCGTTATT AGGTTTCCAA  GCTGTTATTG GGATGTGATT ACTGTTGTCT GTGTAATGAT AAATGTGTTT GCATTGTTCA AAGTTTGGAA TTAACTCGAG GATATATGAC TAATGATGAT CTTGAGAAAG CAATGAAGGA 
TTTCACCAAG AGATGTAGTA AGATTTCGAG ATTATACAGG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAAGGCTTATTCAACACGTGTCCTCACGTTTCTGATATTGATCTCGCTAATGGCGGTGACACTGAACCTTTTTCCCACGGTAGAGGCAAAGAAGCGGAGTAGAGATGCTCCTATA
GTGAAAGGTCTCTCATGGAACTTTTACCAGAAAGCATGTCCGAAAGTCGAAAACATCATCAGAAAAGAGCTCAAGAAAGTCTTCAAGCGAGATATTGGTTTAGCCGCTGCCATCCTTCGT
ATACATTTCCATGATTGCTTCGTTCAG
GTTCGATCTTTTTCTTCCTTTTGTTTTGTTTCTTGTATTAAAACCTAAGAAAACTTAATTTGATTCTTAAAGCCTAGTCTAAACAGTTCTACG
CATGTAAATTACATATTATTTCATTAATAAAAATATCATTTTTTAATATAAGAAACCATATCCAGTTATCCACTCATCACTCGTTATACCCACACACAAAAAAGATTCTCTAGGCATGTC
CGAAATGAAAATGAAATATTCATAAATATCAATAAACTTGTGAGTTTTCTTATTAAAATCCGACCAAAATAACCTTAAAGGAAAACACAAAGTCGCCTCAAAAGTCTCATGAACAAGATT
TAAGGGTTGTCCGATTCTTACTTCACTTTTGTTTTTTTTTCAAAACAAAGGGTTTCTTAGTGTAAACATAACTAAATGACATGTATTATTGGAATAGTATTGTTTATTACAAAATTACTA
CACTTAATATACATGCAAGCTATAAAATAAAATTAAAAAAATACATGCAATAGGACATGTCGCATTAATACTATACACCGGCTTTCCGTATGTTAGTTGGATCTCAGTTATGGAACGTAA
ACATATCTTAAATAATTCAATATCCAACCAATAATAAAAATAATACATATCCGGATATGATAGCATATGTGAATTATTTATATCAACATTTAATGCATCCAATTTTCTGAATAAAATATT
TGATATTTCTCAAGCCAAATACTAAACCTAATTTTGTTTGCAGCAATACTTTAATTATGATTATCAGATTCTTAGAACTTGTAAGTTGCAACACCTTTATATACTTAAAAGTAAATATTA
TCAATAATGATGAATTGTGGCATAATTTGATTAGATATACAATTTCGGAAGAAACTTCAAAATGTATTTTTCATTTTTAATCTTTTTGTTATGAGAAATATCTTCTTTTTTTTTTGTATG
TTATGAGAAATTTTATAAACTAAAATAAACAGGGATGTGAAGCATCAGTGCTGCTAGCTGGATCAGCCAGTGGACCAGGAGAACAATCATCAATCCCAAATCTGACACTACGACAACAAG
CCTTTGTCGTCATTAATAACCTTCGTGCCCTCGTCCAAAAGAAGTGCGGTCAAGTCGTCTCTTGCTCAGATATCCTCGCTCTCGCCGCTCGCGATTCCGTCGTCCTA
GTAACCACATCTA
TCACTTTTTCGTCTATAACTCAATCACATTTAGTTTCAACTAACCTTGGATTATGACTTGCGGTTACATGCAATAATACAAACCATTAGTCTACAAGTCACACTAATTCTCTAACATGAT
AATTATTTTTGTGTGTCAATGTAGTCAGGAGGGCCAGACTATGCTGTCCCACTTGGCCGACGTGACTCTCTAGCGTTCGCGAGCCAGGAAACGACGTTAAATAACTTACCACCACCGTTC
TTCAACGCGAGTCAGCTCATCGCCGACTTCGCCAACAGAAACCTCAACATCACCGACTTAGTAGCACTTTCCGGTGGTCACACCATCGGAATCGCGCATTGTCCGTCTTTCACAGACCGA
CTCTACCCGAACCAAGACCCAACCATGAACCAGTTCTTCGCCAACAGCCTCAAACGCACTTGTCCCACCGCAAACTCGAGCAACACGCAAGTGAATGACATAAGGAGTCCTGACGTGTTC
GACAACAAGTACTACGTTGATCTCATGAACCGACAAGGGCTATTCACTTCTGACCAGGATCTCTTCGTGGATAAGAGGACACGTGGCATTGTGGAAAGCTTTGCGATCGACCAGCAGCTG
TTTTTTGATTATTTTACTGTGGCGATGATCAAGATGGGTCAGATGAGTGTCTTAACTGGAACACAAGGAGAGATTCGTTCCAATTGTTCAGCCAGAAACACCCAAAGTTTCATGTCCGTT
TTGGAAGAAGGCATAGAGGAAGCTATTTCCATGATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAAGGCTTATTCAACACGTGTCCTCACGTTTCTGATATTGATCTCGCTAATGGCGGTGACACTGAACCTTTTTCCCACGGTAGAGGCAAAGAAGCGGAGTAGAGATGCTCCTATA
GTGAAAGGTCTCTCATGGAACTTTTACCAGAAAGCATGTCCGAAAGTCGAAAACATCATCAGAAAAGAGCTCAAGAAAGTCTTCAAGCGAGATATTGGTTTAGCCGCTGCCATCCTTCGT
ATACATTTCCATGATTGCTTCGTTCAG
GGATGTGAAGCATCAGTGCTGCTAGCTGGATCAGCCAGTGGACCAGGAGAACAATCATCAATCCCAAATCTGACACTACGACAACAAGCCTTT
GTCGTCATTAATAACCTTCGTGCCCTCGTCCAAAAGAAGTGCGGTCAAGTCGTCTCTTGCTCAGATATCCTCGCTCTCGCCGCTCGCGATTCCGTCGTCCTA
TCAGGAGGGCCAGACTAT
GCTGTCCCACTTGGCCGACGTGACTCTCTAGCGTTCGCGAGCCAGGAAACGACGTTAAATAACTTACCACCACCGTTCTTCAACGCGAGTCAGCTCATCGCCGACTTCGCCAACAGAAAC
CTCAACATCACCGACTTAGTAGCACTTTCCGGTGGTCACACCATCGGAATCGCGCATTGTCCGTCTTTCACAGACCGACTCTACCCGAACCAAGACCCAACCATGAACCAGTTCTTCGCC
AACAGCCTCAAACGCACTTGTCCCACCGCAAACTCGAGCAACACGCAAGTGAATGACATAAGGAGTCCTGACGTGTTCGACAACAAGTACTACGTTGATCTCATGAACCGACAAGGGCTA
TTCACTTCTGACCAGGATCTCTTCGTGGATAAGAGGACACGTGGCATTGTGGAAAGCTTTGCGATCGACCAGCAGCTGTTTTTTGATTATTTTACTGTGGCGATGATCAAGATGGGTCAG
ATGAGTGTCTTAACTGGAACACAAGGAGAGATTCGTTCCAATTGTTCAGCCAGAAACACCCAAAGTTTCATGTCCGTTTTGGAAGAAGGCATAGAGGAAGCTATTTCCATGATCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAAGGACTG AAGGACCAAA ATTGCCTATA AAAGCAAAGT CCATCTATTC CACAAGAACA AGAAAAGGCA GAGAAGAGAG AGGCTCTGAT AAAAAAAAAA ACAAAAAAAA ATGACAAAGG  CTTATTCAAC ACGTGTCCTC ACGTTTCTGA TATTGATCTC GCTAATGGCG GTGACACTGA ACCTTTTTCC CACGGTAGAG GCAAAGAAGC GGAGTAGAGA TGCTCCTATA GTGAAAGGTC  TCTCATGGAA CTTTTACCAG AAAGCATGTC CGAAAGTCGA AAACATCATC AGAAAAGAGC TCAAGAAAGT CTTCAAGCGA GATATTGGTT TAGCCGCTGC CATCCTTCGT ATACATTTCC  ATGATTGCTT CGTTCAGGGA TGTGAAGCAT CAGTGCTGCT AGCTGGATCA GCCAGTGGAC CAGGAGAACA ATCATCAATC CCAAATCTGA CACTACGACA ACAAGCCTTT GTCGTCATTA  ATAACCTTCG TGCCCTCGTC CAAAAGAAGT GCGGTCAAGT CGTCTCTTGC TCAGATATCC TCGCTCTCGC CGCTCGCGAT TCCGTCGTCC TATCAGGAGG GCCAGACTAT GCTGTCCCAC  TTGGCCGACG TGACTCTCTA GCGTTCGCGA GCCAGGAAAC GACGTTAAAT AACTTACCAC CACCGTTCTT CAACGCGAGT CAGCTCATCG CCGACTTCGC CAACAGAAAC CTCAACATCA  CCGACTTAGT AGCACTTTCC GGTGGTCACA CCATCGGAAT CGCGCATTGT CCGTCTTTCA CAGACCGACT CTACCCGAAC CAAGACCCAA CCATGAACCA GTTCTTCGCC AACAGCCTCA  AACGCACTTG TCCCACCGCA AACTCGAGCA ACACGCAAGT GAATGACATA AGGAGTCCTG ACGTGTTCGA CAACAAGTAC TACGTTGATC TCATGAACCG ACAAGGGCTA TTCACTTCTG  ACCAGGATCT CTTCGTGGAT AAGAGGACAC GTGGCATTGT GGAAAGCTTT GCGATCGACC AGCAGCTGTT TTTTGATTAT TTTACTGTGG CGATGATCAA GATGGGTCAG ATGAGTGTCT  TAACTGGAAC ACAAGGAGAG ATTCGTTCCA ATTGTTCAGC CAGAAACACC CAAAGTTTCA TGTCCGTTTT GGAAGAAGGC ATAGAGGAAG CTATTTCCAT GATCTAAATA ACCATAAATC 
TCGACCTTTC CTTTGTCAAC TCTGTTTTTA TTTAGTTCAT GCACTTGTGG TTGGGTTGTC GAATGCGTAA AACTATCTGA TAAATAAGAA CGTCGCTTCA TCTTAATTAA CTTCATCC 

Retrieve as FASTA