Entry information : PpePrx60 (ppa020321m)
Entry ID 9300
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx60 (ppa020321m)
Name (synonym) PpePrx60 (ppa020321m)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx60
start..stop
S start..stop
VvPrx89 532 0 1..342 13..352
GmPrx296 531 0 1..342 2..333
AfpPrx12 529 0 32..342 151..453
CpapPrx09 525 0 4..342 19..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 33010662..33010740 79 N° 2 33010777..33010931 155 N° 3 33011068..33011259 192 N° 4 33011350..33011515 166
N° 5 33011603..33012036 434  
join(33010662..33010740,33010777..33010931,33011068..33011259,33011350..33011515 ,33011603..33012036)


exon

Literature and cross-references PpePrx60 (ppa020321m)
DNA ref. Phytozome 12:   scaffold_1 (33010662..33012036)
Protein sequence: PpePrx60 (ppa020321m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342
PWM (Da):   %s   36726.52  
PI (pH):   %s   8.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALFSAGTLSLAHPAGFNFGWGSGWGTGGSFGLFPQFYQFSCPQANDIVISVLQQAIAREPRAAASLLRLHFHDCFVGCDASVLLDDSTTIASEKRSGPNRNSLRGFEVIDEIKAKLEEACPQTVSCADILALAARGSIVLSGGPNWDLPLGRRDSRTASLSGSNSNIPAPNSTLSTLLTFFKRQGLDEVDLVALSGGHTIGVARCVTFKQRLYNQKGNNQPDETLERNYYFGLKSVCPRSGGDNNISPLDFASPAKFDNAYFKLILFGKGLLTSDQVLLTGNGNGNGIGNAGKTMELVKTYADDESLFFQQFAKSMVKMGNIRPLTGSKGEVRNNCRRL

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGTTCTCAGCCGGTACTCTGTCCCTAGCTCACCCCGCCGGTTTCAACTTCGGGTGGGGATCCGGGTGGGGCAGTGAACCTAGTAGGGGTCATGGTGGATATGCACCAGCTGGC
GGGTCTTTTGGTCTTTTTCCGCAATTCTATCAGTTCTCATGCCCTCAAGCTAATGACATTGTCATCTCTGTGTTACAGCAGGCCATTGCGAGGGAGCCCAGGGCGGCTGCCTCTTTGCTT
AGGCTTCACTTCCATGACTGCTTTGTTCAG
GTTATTTTCAAATTCAAAGGCCTTTCGCTATTTACAAAGATTATTTATTGCCGCCACTAGTTGATTGCATAAATATAAAGTCATATTTAT
ATACGTGCATGGCTTAATGTTATTATGATATGATGATTGGCTACAGGGCTGTGATGCGTCGGTACTATTGGACGACAGCACGACGATAGCCAGCGAAAAGAGGTCAGGTCCAAACAGGAA
TTCGCTGAGAGGATTTGAAGTGATAGATGAGATCAAGGCCAAGTTGGAAGAAGCATGTCCCCAAACTGTCTCTTGTGCTGACATTCTTGCTCTGGCTGCAAGGGGGTCCATTGTTCTA
GT
AAGAAACCAAATTATAGTTAATTAGTATAATTAAGCCTCAACTATTTAATTACTACTACTAACAAGTGAAGTTGGTGGAATGGAACAGAGCGGTGGGCCTAATTGGGATTTACCACTAGG
AAGGAGAGACTCAAGAACTGCTAGCCTGAGTGGCTCAAACAGCAACATCCCCGCACCAAACTCAACTCTCTCAACCCTCTTAACCTTCTTCAAGCGTCAAGGCCTCGACGAAGTAGACTT
AGTTGCACTCTCAG
GTACTTCAATTATATATAATTCATCATTATTATCGTTTGATTATTTCTGCAAACGAACACTTAATGATATGATTTTGATGAATGCAGGAGGGCATACCATTGGGGT
TGCGAGGTGCGTGACGTTCAAGCAGAGGTTGTACAACCAAAAGGGCAACAACCAACCAGACGAGACTCTAGAGAGAAACTACTACTTTGGTTTGAAATCAGTTTGCCCAAGATCAGGTGG
TGACAATAACATTAGCCCCTTGGACTTTGCATCCCCTGCCAAATTTGACAACGCCTACTTCAAGCTCATTCTCTTTGGTAAAGGCCTTCTGACTTCAGACCAAGTGCTTCTCACTGGCAA
TGGCAATGGCAATGGCATTGGCAATGCAGGGAAGACCATGGAGCTGGTCAAAACCTATGCAGATGATGAGAGCCTCTTCTTTCAGCAGTTTGCCAAGTCAATGGTTAAGATGGGGAACAT
CAGGCCTCTCACTGGATCTAAGGGTGAAGTTAGAAACAATTGTCGCCGACTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGTTCTCAGCCGGTACTCTGTCCCTAGCTCACCCCGCCGGTTTCAACTTCGGGTGGGGATCCGGGTGGGGCACTGGCGGGTCTTTTGGTCTTTTTCCGCAATTCTATCAGTTC
TCATGCCCTCAAGCTAATGACATTGTCATCTCTGTGTTACAGCAGGCCATTGCGAGGGAGCCCAGGGCGGCTGCCTCTTTGCTTAGGCTTCACTTCCATGACTGCTTTGTTCAG
GGCTGT
GATGCGTCGGTACTATTGGACGACAGCACGACGATAGCCAGCGAAAAGAGGTCAGGTCCAAACAGGAATTCGCTGAGAGGATTTGAAGTGATAGATGAGATCAAGGCCAAGTTGGAAGAA
GCATGTCCCCAAACTGTCTCTTGTGCTGACATTCTTGCTCTGGCTGCAAGGGGGTCCATTGTTCTA
AGCGGTGGGCCTAATTGGGATTTACCACTAGGAAGGAGAGACTCAAGAACTGCT
AGCCTGAGTGGCTCAAACAGCAACATCCCCGCACCAAACTCAACTCTCTCAACCCTCTTAACCTTCTTCAAGCGTCAAGGCCTCGACGAAGTAGACTTAGTTGCACTCTCAG
GAGGGCAT
ACCATTGGGGTTGCGAGGTGCGTGACGTTCAAGCAGAGGTTGTACAACCAAAAGGGCAACAACCAACCAGACGAGACTCTAGAGAGAAACTACTACTTTGGTTTGAAATCAGTTTGCCCA
AGATCAGGTGGTGACAATAACATTAGCCCCTTGGACTTTGCATCCCCTGCCAAATTTGACAACGCCTACTTCAAGCTCATTCTCTTTGGTAAAGGCCTTCTGACTTCAGACCAAGTGCTT
CTCACTGGCAATGGCAATGGCAATGGCATTGGCAATGCAGGGAAGACCATGGAGCTGGTCAAAACCTATGCAGATGATGAGAGCCTCTTCTTTCAGCAGTTTGCCAAGTCAATGGTTAAG
ATGGGGAACATCAGGCCTCTCACTGGATCTAAGGGTGAAGTTAGAAACAATTGTCGCCGACTTAAT

Retrieve as FASTA