Entry information : PpePrx62 ( ppa020970m)
Entry ID 9302
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-28 (Christophe Dunand)
Peroxidase information: PpePrx62 ( ppa020970m)
Name (synonym) PpePrx62 ( ppa020970m)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx62
start..stop
S start..stop
RcPrx67 549 0 1..324 1..323
EgrPrx56 541 0 13..324 12..323
EgrPrx102 540 0 1..324 1..323
MePrx90 540 0 1..324 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24734184..24734405 222 N° 2 24733848..24734036 189 N° 3 24733194..24733754 561  
complement(join(24733194..24733754,24733848..24734036,24734184..24734405))


exon

Literature and cross-references PpePrx62 ( ppa020970m)
DNA ref. Phytozome 11:   scaffold_2 (24734405..24733194)
Protein sequence: PpePrx62 ( ppa020970m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (297)
PWM (Da):   %s   35884.02 (32906.5)  
PI (pH):   %s   8.47 (8.20) Peptide Signal:   %s   cut: 28 range:28-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMYAPKTILFHTLICLLLTMASQSKASLNSNYYHQTCPQAEKIILQTVYNAFMHDPKIPARILRMFFHDCFIRGCDASLLLDSTPGNQAEKDGPPNISVRSFYVIDDAKAKLEMACPRTVSCADIIGIAARDVVTMSGGPYWNVLKGRKDGRVSRANETINLPAPTFNVSQLIQSFARRGLGVKELVALSGGHTLGFSHCSSFESRLRNFTSLHDVDPSMNNEFAQKLRKKCPKPNRDRTAGELLDSTSSTFDNDYYKQVVAGKGVFGSDQALFSDYRTRWIVESFAEDQSLFFKEFAASMVKLGNAGVIEDGEVRLNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Incorrect prediction from Phytozome (Bad prediction at 5' end).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGTATGCACCAAAAACAATCTTGTTCCACACATTAATCTGTCTTTTGTTAACTATGGCTTCACAATCAAAAGCATCGCTCAATTCCAACTATTATCATCAAACATGTCCACAA
GCTGAGAAAATCATATTACAGACGGTATATAACGCTTTCATGCATGACCCTAAAATCCCAGCTCGTATCTTAAGGATGTTTTTCCATGATTGTTTCATAAGG
GTATAANNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATGTAGGGTTAGGTGTATAATTAGCTTGTGTTTGCTTTTTG
GTTACTTAGGGATGTGATGCATCGTTGCTGCTAGACTCAACCCCAGGGAACCAAGCAGAAAAAGATGGTCCTCCCAATATCTCAGTCCGATCATTCTACGTGATCGACGATGCCAAAGCT
AAGCTAGAAATGGCATGTCCACGCACTGTTTCTTGTGCTGATATCATTGGCATTGCCGCAAGAGACGTAGTTACCATG
GTACGTCCCGTACGTTTATGTTACTAAATTTATGTTGCCTGA
CAAATGTTTATGTATACAAGAGTAATATGTACATTGTTTATTTCTTGATAGTCCGGAGGTCCTTACTGGAATGTGCTAAAAGGGAGGAAAGATGGCAGGGTTTCGAGAGCTAACGAGACC
ATCAACTTACCAGCTCCAACTTTCAACGTATCCCAATTGATCCAAAGCTTTGCTAGGAGGGGCTTGGGTGTTAAAGAATTGGTTGCCCTATCTGGCGGCCACACTCTTGGGTTCTCACAT
TGTTCTTCTTTTGAATCCCGGCTTCGAAATTTTACTTCATTGCATGATGTTGATCCAAGCATGAACAATGAATTTGCTCAAAAGCTAAGAAAGAAATGCCCAAAACCAAACAGGGATCGC
ACTGCCGGAGAGTTGTTGGACTCAACTTCCTCAACGTTTGATAATGATTATTACAAGCAAGTAGTGGCAGGAAAGGGCGTGTTTGGATCGGATCAAGCGTTGTTTAGTGATTACAGGACT
AGATGGATTGTTGAATCATTTGCTGAGGATCAAAGTTTGTTCTTTAAGGAGTTTGCAGCTTCTATGGTGAAACTTGGAAATGCTGGCGTGATTGAGGATGGTGAAGTGAGACTGAATTGC
CGAGTGGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGTATGCACCAAAAACAATCTTGTTCCACACATTAATCTGTCTTTTGTTAACTATGGCTTCACAATCAAAAGCATCGCTCAATTCCAACTATTATCATCAAACATGTCCACAA
GCTGAGAAAATCATATTACAGACGGTATATAACGCTTTCATGCATGACCCTAAAATCCCAGCTCGTATCTTAAGGATGTTTTTCCATGATTGTTTCATAAGG
GGATGTGATGCATCGTTG
CTGCTAGACTCAACCCCAGGGAACCAAGCAGAAAAAGATGGTCCTCCCAATATCTCAGTCCGATCATTCTACGTGATCGACGATGCCAAAGCTAAGCTAGAAATGGCATGTCCACGCACT
GTTTCTTGTGCTGATATCATTGGCATTGCCGCAAGAGACGTAGTTACCATG
TCCGGAGGTCCTTACTGGAATGTGCTAAAAGGGAGGAAAGATGGCAGGGTTTCGAGAGCTAACGAGACC
ATCAACTTACCAGCTCCAACTTTCAACGTATCCCAATTGATCCAAAGCTTTGCTAGGAGGGGCTTGGGTGTTAAAGAATTGGTTGCCCTATCTGGCGGCCACACTCTTGGGTTCTCACAT
TGTTCTTCTTTTGAATCCCGGCTTCGAAATTTTACTTCATTGCATGATGTTGATCCAAGCATGAACAATGAATTTGCTCAAAAGCTAAGAAAGAAATGCCCAAAACCAAACAGGGATCGC
ACTGCCGGAGAGTTGTTGGACTCAACTTCCTCAACGTTTGATAATGATTATTACAAGCAAGTAGTGGCAGGAAAGGGCGTGTTTGGATCGGATCAAGCGTTGTTTAGTGATTACAGGACT
AGATGGATTGTTGAATCATTTGCTGAGGATCAAAGTTTGTTCTTTAAGGAGTTTGCAGCTTCTATGGTGAAACTTGGAAATGCTGGCGTGATTGAGGATGGTGAAGTGAGACTGAATTGC
CGAGTGGTGAAC

Retrieve as FASTA