Entry information : PpePrx[P]69 (ppa023401m)
Entry ID 9309
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-01-08 (Christophe Dunand)
Peroxidase information: PpePrx[P]69 (ppa023401m)
Name (synonym) PpePrx[P]69 (ppa023401m)
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx[P]69
start..stop
S start..stop
EgrPrx45 313 7e-108 9..263 6..322
EglPrx45 313 7e-108 9..263 6..322
EguPrx45 303 9e-104 18..263 15..322
EgrPrx43 302 2e-103 58..263 119..322
EgrPrx43 97 1e-23 9..71 6..68
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26237083..26237295 213 N° 2 26236554..26236719 166 N° 3 26236031..26236440 410  
complement(join(26236031..26236440,26236554..26236719,26237083..26237295))


exon

Literature and cross-references PpePrx[P]69 (ppa023401m)
DNA ref. Phytozome 12:   scaffold_2 (26237295..26236031)
Protein sequence: PpePrx[P]69 (ppa023401m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   263 (239)
PWM (Da):   %s   29041.77 (26370.3)  
PI (pH):   %s   10.33 (10.09) Peptide Signal:   %s   cut: 25 range:25-263
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRPQNLNRVSIVLIAALLCRSVHSQLQVGFYTTSCTLAELIVKDEVRKGFFKNPGVAAGLVRLHFHDCFVRTRGLGYIVPAGRRDGKISQASDTFTNLPPPSFNVDQLSKLFANKGFTQEEMVTLSGAHTIGRSHCTAFSNRLYNFNRTSRQDPSLDPPYAAQLKRQCQQGNSSPNFVVPMNPASPAVTDTSYYADFLTNRGLFTSDQTLLTNSATANQVNQNAKMPFLWRTKFAYAMVKMGRLQVLTGNAGEIRANCRVIN

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Exon 2 is missing (only GCDASVLIDST can be detected). No EST found. Incorrect prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACCACAAAATCTAAATCGTGTATCTATTGTTTTAATTGCTGCTTTGTTATGTCGAAGTGTGCATTCACAGCTCCAAGTTGGGTTTTATACAACTTCATGTACCTTAGCGGAGTTA
ATCGTCAAGGACGAGGTTAGAAAAGGGTTCTTTAAGAACCCAGGAGTTGCAGCTGGTCTTGTAAGATTGCACTTCCATGACTGCTTTGTTAGA
GTAAGATTAATGTCCCCTAATTAAGGC
AACTTATTGTTTTCATGTTATCAATGGTTCAACTTAACAAGGAACATAAGTATATTGGTAGATTCTAACATGCACGTATGTTCCTCCTTTTGACTTGACTACTAGAAATGAGGTTACAAT
TGTATACTAGCTGTCAGGCTTGAGCTATTTGAGTTTGACAGAGAGGGTAAACTAATTTAATTTGTTGCTTCTTTAGGGCTGTGATGCATCGGTGCTCATTGATTCCACTTCCTTAATTTG
GGCCCCTATATCTCCCTAATATACGTACGTATGTGTGTGTGTGTGTGTGGCTACTTTTTGTATCAATTTCTTATCAAATCTGTGATCTCCATGCAGACTAGAGGGCTTGGATATATCGTT
CCTGCTGGAAGAAGAGATGGCAAAATTTCACAAGCTTCAGACACATTCACGAACTTACCTCCCCCATCATTCAATGTCGACCAGCTCAGTAAACTTTTTGCAAACAAGGGTTTTACACAA
GAAGAAATGGTTACTCTCTCTG
GTATTAACAACTCTGATCTGAATTCTTCCTTGTGAAAATCCTAAACACTTTTCTGTTGCTTTCTATTAAGTAACAAATACAGATGCTAATGAATCAGA
TACTGTGATTTACAGGAGCACACACCATTGGCCGCTCTCATTGCACAGCTTTCAGTAACAGATTGTACAATTTTAACAGAACATCAAGGCAGGACCCAAGTTTAGACCCCCCGTACGCTG
CTCAGTTGAAGCGGCAATGCCAACAGGGCAACTCAAGTCCAAATTTTGTGGTTCCGATGAACCCCGCCAGCCCTGCTGTCACTGACACCAGCTACTACGCCGACTTTCTTACAAACCGAG
GTTTGTTTACATCAGACCAAACTCTCCTCACAAACTCAGCAACCGCAAACCAAGTCAATCAAAATGCCAAAATGCCCTTCCTTTGGAGGACTAAATTCGCTTATGCAATGGTGAAGATGG
GCAGACTTCAAGTCTTAACAGGCAATGCTGGTGAGATTCGAGCAAATTGCAGGGTTATTAACAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACCACAAAATCTAAATCGTGTATCTATTGTTTTAATTGCTGCTTTGTTATGTCGAAGTGTGCATTCACAGCTCCAAGTTGGGTTTTATACAACTTCATGTACCTTAGCGGAGTTA
ATCGTCAAGGACGAGGTTAGAAAAGGGTTCTTTAAGAACCCAGGAGTTGCAGCTGGTCTTGTAAGATTGCACTTCCATGACTGCTTTGTTAGA
ACTAGAGGGCTTGGATATATCGTTCCT
GCTGGAAGAAGAGATGGCAAAATTTCACAAGCTTCAGACACATTCACGAACTTACCTCCCCCATCATTCAATGTCGACCAGCTCAGTAAACTTTTTGCAAACAAGGGTTTTACACAAGAA
GAAATGGTTACTCTCTCTG
GAGCACACACCATTGGCCGCTCTCATTGCACAGCTTTCAGTAACAGATTGTACAATTTTAACAGAACATCAAGGCAGGACCCAAGTTTAGACCCCCCGTAC
GCTGCTCAGTTGAAGCGGCAATGCCAACAGGGCAACTCAAGTCCAAATTTTGTGGTTCCGATGAACCCCGCCAGCCCTGCTGTCACTGACACCAGCTACTACGCCGACTTTCTTACAAAC
CGAGGTTTGTTTACATCAGACCAAACTCTCCTCACAAACTCAGCAACCGCAAACCAAGTCAATCAAAATGCCAAAATGCCCTTCCTTTGGAGGACTAAATTCGCTTATGCAATGGTGAAG
ATGGGCAGACTTCAAGTCTTAACAGGCAATGCTGGTGAGATTCGAGCAAATTGCAGGGTTATTAACAGC

Retrieve as FASTA