Entry information : PpePrx72 (ppa023689m)
Entry ID 9312
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-11 (Christophe Dunand)
Peroxidase information: PpePrx72 (ppa023689m)
Name (synonym) PpePrx72 (ppa023689m)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx72
start..stop
S start..stop
VvPrx48 529 0 25..340 26..339
MePrx12 528 0 1..340 3..340
PtPrx92 528 0 11..340 12..341
MtPrx40 527 0 10..340 9..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28461152..28461385 234 N° 2 28461562..28461753 192 N° 3 28461899..28462064 166 N° 4 28462237..28462664 428
join(28461152..28461385,28461562..28461753,28461899..28462064,28462237..28462664 )


exon

Literature and cross-references PpePrx72 (ppa023689m)
DNA ref. Phytozome 12:   scaffold_1 (28461152..28462664)
Protein sequence: PpePrx72 (ppa023689m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (312)
PWM (Da):   %s   36864.55 (33678.9)  
PI (pH):   %s   4.99 (4.86) Peptide Signal:   %s   cut: 29 range:29-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPSLCFRTFILQFMLLVFSILNTSLQASEPQLTLDYYASACPNLFDIVKKEMECAVLSDPRNAALIVRLHFHDCFVQGCDGSVLLDDTITLTGEKKASPNIHSLKGFRIIDKIKNNLESECPGIVSCADILTIAARDAVILVGGPYWDVPLGRKDSITASPELAEANLPTANEGLATIISKFLYQGLSVTDMVALSGAHTIGMARCKNVRARIYGGDFEATSGSNPLSQSYLSSLKSTCPPVGGVGDNNVTAMDYVTPDLFDNSFYHLLLKGEGLLSSDQEMYSSLFGIQTKQLVKQYAADPVAFFQQFSDSMVKLGNITNQDSFATGEVRKICRFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCTTCCCTTTGTTTCAGAACCTTCATTCTTCAATTCATGCTTTTGGTTTTCTCCATTTTGAACACCAGTTTGCAAGCAAGTGAGCCTCAATTGACATTGGACTACTATGCATCT
GCATGTCCTAATTTGTTCGATATTGTCAAGAAAGAAATGGAATGTGCAGTGCTCTCGGATCCTCGCAACGCCGCCTTGATTGTTCGGTTACATTTCCATGACTGCTTTGTTCAG
GTCCAT
AATGTTATTTATTGATGAGTTACATAGGATTTTTTGTTTCTCATCATGCAATATTTTTCAATGATCATTATTTTTTCGTAGTTTCAAGTTGCTGCAGTATACACTTCAGTACTATAGAAT
TTATAGAAATTTAAGAGAACCATATTTGATTTATTGAATCATGCACGCAGGGATGTGATGGGTCAGTTTTGCTCGATGATACAATCACACTAACAGGGGAGAAGAAAGCTTCCCCCAACA
TACACTCCTTAAAGGGTTTCAGAATTATTGACAAAATCAAGAACAATCTCGAATCAGAGTGCCCTGGAATTGTCTCTTGTGCCGATATTCTCACAATTGCAGCAAGAGATGCTGTGATTC
TG
GTACTAATTAGAAAACTCTTATATATATATATATAAACATATGAGTTCCATATATACCACCTACTAAAAATCTCTCTGATATATTTGTGTCAAGTCTTATTCAAAGCAGAGTTTTTAG
CCTTGTTTCTTTGTTTTCACCGTGCAGGTTGGTGGACCTTATTGGGATGTTCCTCTGGGAAGAAAAGATTCTATAACTGCTAGTCCTGAGCTTGCAGAGGCTAACCTTCCTACTGCTAAT
GAGGGCCTTGCAACTATCATTTCCAAATTTCTTTACCAAGGCCTGTCAGTCACAGATATGGTAGCTCTATCAG
GTACTTGAGAAAAGGTCCAAATCTTATTGCATGTGATGTGACATTCC
TCTCGCAACATGTATCTCGTAAAAGGGCCTTGTAAATATCATATTCATAGCATTATTCAGGATTTGATATGGTAATTAAGTGATGCATTTCCTATTGAGCATTTTGTGCATAATCAATCT
TTTAGGGGCTCACACAATCGGCATGGCACGGTGTAAGAATGTCCGGGCAAGGATTTATGGTGGTGATTTTGAAGCAACCTCAGGAAGCAATCCTCTGTCTCAATCATACCTCAGCAGTTT
GAAATCCACATGCCCACCTGTTGGTGGAGTTGGGGACAATAACGTTACAGCCATGGACTATGTGACTCCTGACCTGTTTGACAATTCTTTCTATCATTTACTATTGAAAGGAGAGGGTTT
GCTGAGCTCAGACCAGGAAATGTACTCTAGCCTGTTTGGCATTCAAACAAAGCAACTTGTCAAGCAGTATGCAGCAGACCCAGTTGCTTTCTTCCAGCAATTCTCAGATTCAATGGTGAA
GCTGGGAAATATTACCAATCAGGACAGCTTTGCCACTGGAGAAGTTAGGAAAATTTGCAGATTTGTGAACACA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCTTCCCTTTGTTTCAGAACCTTCATTCTTCAATTCATGCTTTTGGTTTTCTCCATTTTGAACACCAGTTTGCAAGCAAGTGAGCCTCAATTGACATTGGACTACTATGCATCT
GCATGTCCTAATTTGTTCGATATTGTCAAGAAAGAAATGGAATGTGCAGTGCTCTCGGATCCTCGCAACGCCGCCTTGATTGTTCGGTTACATTTCCATGACTGCTTTGTTCAG
GGATGT
GATGGGTCAGTTTTGCTCGATGATACAATCACACTAACAGGGGAGAAGAAAGCTTCCCCCAACATACACTCCTTAAAGGGTTTCAGAATTATTGACAAAATCAAGAACAATCTCGAATCA
GAGTGCCCTGGAATTGTCTCTTGTGCCGATATTCTCACAATTGCAGCAAGAGATGCTGTGATTCTG
GTTGGTGGACCTTATTGGGATGTTCCTCTGGGAAGAAAAGATTCTATAACTGCT
AGTCCTGAGCTTGCAGAGGCTAACCTTCCTACTGCTAATGAGGGCCTTGCAACTATCATTTCCAAATTTCTTTACCAAGGCCTGTCAGTCACAGATATGGTAGCTCTATCAG
GGGCTCAC
ACAATCGGCATGGCACGGTGTAAGAATGTCCGGGCAAGGATTTATGGTGGTGATTTTGAAGCAACCTCAGGAAGCAATCCTCTGTCTCAATCATACCTCAGCAGTTTGAAATCCACATGC
CCACCTGTTGGTGGAGTTGGGGACAATAACGTTACAGCCATGGACTATGTGACTCCTGACCTGTTTGACAATTCTTTCTATCATTTACTATTGAAAGGAGAGGGTTTGCTGAGCTCAGAC
CAGGAAATGTACTCTAGCCTGTTTGGCATTCAAACAAAGCAACTTGTCAAGCAGTATGCAGCAGACCCAGTTGCTTTCTTCCAGCAATTCTCAGATTCAATGGTGAAGCTGGGAAATATT
ACCAATCAGGACAGCTTTGCCACTGGAGAAGTTAGGAAAATTTGCAGATTTGTGAACACA

Retrieve as FASTA