Entry information : PpePrx75 ( ppa025326m)
Entry ID 9315
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-18 (Christophe Dunand)
Peroxidase information: PpePrx75 ( ppa025326m)
Name (synonym) PpePrx75 ( ppa025326m)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx75
start..stop
S start..stop
VvPrx28 524 0 2..320 14..333
VvPrx27 521 0 2..320 13..332
VvPrx39 516 0 2..320 3..322
EcamPrx151 501 0 1..320 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25779907..25780101 195 N° 2 25779038..25779802 765  
complement(join(25779038..25779802,25779907..25780101))


exon

Literature and cross-references PpePrx75 ( ppa025326m)
DNA ref. Phytozome 12:   scaffold_6 (25780101..25779038)
Protein sequence: PpePrx75 ( ppa025326m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (302)
PWM (Da):   %s   34792.59 (32755.6)  
PI (pH):   %s   9.11 (9.11) Peptide Signal:   %s   cut: 19 range:19-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLIFFLAMFMVVFMASAAPKVGFYQRSCPSAEAIVRKAVNKAVAKNPGIAAGLIRMHFHDCFVRGCDASILLDSTPGQPSEKEHPANNPSLRGFEVIDEAKAEIEAKCPKTVSCADILAFAARDSALKVGGINYDVPSGRRDGRVSLQDEPTQHLPPPSFNAKQLEDSFARKGLSLDEMVTLSGAHSIGVSHCSSFSDRLYFFNATHPQDPSMDPIFARNLKKKCPRSSNNDRVTVPLDVLTPNRLDNKYYTDLKNHHGLLTSDQTLLTSRSTAGIVRNNARFGAAWANKFAAAMVKMGSIDVLTGRQGEIRNNCKVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTTGATATTCTTTTTGGCCATGTTTATGGTGGTCTTCATGGCATCAGCAGCTCCGAAAGTCGGTTTCTATCAACGGAGTTGTCCTTCTGCAGAGGCAATTGTGAGAAAAGCTGTG
AACAAAGCTGTGGCAAAGAATCCAGGCATAGCTGCTGGCCTCATCAGAATGCATTTCCATGATTGCTTTGTTAGG
GTAAGCTTCATTCACATGCATGAATAATATTCTACATTTTATAAT
TAAGTATATTAGAACTAATAATTAATCACAACTAACATATATGTTCTTTATTGTTTCAGGGTTGTGATGCCTCTATCCTACTTGATTCAACTCCTGGACAACCATCCGAAAAAGAACATC
CAGCAAACAATCCGAGCTTGAGAGGCTTTGAAGTGATCGATGAGGCCAAGGCCGAGATTGAAGCTAAATGCCCCAAAACCGTGTCATGTGCTGACATCCTTGCATTTGCTGCTCGTGACA
GTGCACTCAAAGTTGGTGGGATAAATTATGACGTGCCTTCGGGGCGGCGAGATGGAAGAGTTTCCCTCCAAGATGAGCCTACGCAGCACCTCCCCCCACCTTCCTTCAACGCCAAGCAAC
TTGAGGATAGTTTCGCCCGAAAAGGCCTTAGCTTGGATGAAATGGTCACATTATCTGGGGCACATTCTATTGGCGTGTCACATTGTTCTTCCTTCTCTGATCGCTTGTATTTCTTCAATG
CTACTCATCCACAAGACCCTTCAATGGATCCCATTTTTGCTCGAAACTTGAAAAAGAAGTGCCCTCGATCATCAAACAATGATCGAGTTACGGTGCCACTTGATGTTCTTACACCAAATA
GGCTTGACAACAAGTACTATACTGATTTGAAGAACCATCATGGCCTGCTTACATCAGATCAAACTCTTCTTACCAGCCGTTCGACAGCCGGGATTGTGAGGAACAATGCCAGATTTGGTG
CAGCTTGGGCTAATAAGTTTGCAGCAGCCATGGTGAAAATGGGCTCCATTGATGTCCTCACAGGAAGGCAAGGTGAGATCAGGAACAACTGCAAGGTTGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTTGATATTCTTTTTGGCCATGTTTATGGTGGTCTTCATGGCATCAGCAGCTCCGAAAGTCGGTTTCTATCAACGGAGTTGTCCTTCTGCAGAGGCAATTGTGAGAAAAGCTGTG
AACAAAGCTGTGGCAAAGAATCCAGGCATAGCTGCTGGCCTCATCAGAATGCATTTCCATGATTGCTTTGTTAGG
GGTTGTGATGCCTCTATCCTACTTGATTCAACTCCTGGACAACCA
TCCGAAAAAGAACATCCAGCAAACAATCCGAGCTTGAGAGGCTTTGAAGTGATCGATGAGGCCAAGGCCGAGATTGAAGCTAAATGCCCCAAAACCGTGTCATGTGCTGACATCCTTGCA
TTTGCTGCTCGTGACAGTGCACTCAAAGTTGGTGGGATAAATTATGACGTGCCTTCGGGGCGGCGAGATGGAAGAGTTTCCCTCCAAGATGAGCCTACGCAGCACCTCCCCCCACCTTCC
TTCAACGCCAAGCAACTTGAGGATAGTTTCGCCCGAAAAGGCCTTAGCTTGGATGAAATGGTCACATTATCTGGGGCACATTCTATTGGCGTGTCACATTGTTCTTCCTTCTCTGATCGC
TTGTATTTCTTCAATGCTACTCATCCACAAGACCCTTCAATGGATCCCATTTTTGCTCGAAACTTGAAAAAGAAGTGCCCTCGATCATCAAACAATGATCGAGTTACGGTGCCACTTGAT
GTTCTTACACCAAATAGGCTTGACAACAAGTACTATACTGATTTGAAGAACCATCATGGCCTGCTTACATCAGATCAAACTCTTCTTACCAGCCGTTCGACAGCCGGGATTGTGAGGAAC
AATGCCAGATTTGGTGCAGCTTGGGCTAATAAGTTTGCAGCAGCCATGGTGAAAATGGGCTCCATTGATGTCCTCACAGGAAGGCAAGGTGAGATCAGGAACAACTGCAAGGTTGTGAAC

Retrieve as FASTA