Entry information : PpePrx77 ( ppa026551m)
Entry ID 9317
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-27 (Christophe Dunand)
Peroxidase information: PpePrx77 ( ppa026551m)
Name (synonym) PpePrx77 ( ppa026551m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx77
start..stop
S start..stop
GrPrx02 529 0 2..343 1..339
QrobPrx02 516 0 28..342 22..336
JcPrx01 514 0 13..343 4..334
BrPrx26-1Aa_other 510 0 10..341 6..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18504681..18504944 264 N° 2 18505479..18505658 180 N° 3 18506008..18506167 160 N° 4 18506805..18507229 425
join(18504681..18504944,18505479..18505658,18506008..18506167,18506805..18507229 )


exon

Literature and cross-references PpePrx77 ( ppa026551m)
DNA ref. Phytozome 12:   scaffold_1 (18504681..18507229)
Protein sequence: PpePrx77 ( ppa026551m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (312)
PWM (Da):   %s   38054.38 (34697.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.92 (8.98) Peptide Signal:   %s   cut: 32 range:32-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMMRSQISFVFLVLPCLGLVTLSLCLGFVSAASSLPQPNKLTWHYYKIHNTCHEAEIYVRHQVQLLWNKDKTITPKLLRLLYSDCFVTGCDASVLLDGPNSEKTAPQNYGLGGFVFIDKVKSVLEQRCPGVVSCADILNLAARDAVHLAGAPSYPVLTGRRDGLTSSKSSVDLPSPSISWQAALTYFKSRGLDVLDMTTLLGAHSMGKTHCRYIVDRLYNFNNTGKPDPSMERSFISDMRKLCPPRTKKGQSDPLVYLNPGFGANHTFTESYYSRVLSHKAVLGIDQQLLYGDDTKEITKEFAAGFEDFRKSFALSINRMGAYQVLTGNQGEIRKNCRIPNK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATGAGAAGCCAAATATCATTTGTGTTTCTTGTTCTCCCATGTTTGGGTCTAGTTACTCTGAGCTTGTGTCTAGGGTTTGTGAGTGCTGCTTCTTCGTTGCCACAGCCTAACAAG
TTGACTTGGCATTATTACAAAATCCATAATACTTGTCATGAAGCAGAGATTTATGTAAGGCACCAAGTGCAGTTGCTTTGGAACAAGGATAAAACCATCACCCCCAAGCTCCTCAGGTTG
CTCTACTCCGATTGCTTCGTCACG
GTATGTGCTTCTAATCATTTCTACTCAGCTTGCTCCTCCTCATTGTTTCTCAGATCAATTAAATTTGTGTATGTATCTTTGTTTTTGTGGCCAAAG
TGAAGCAATGAAAGCTTTTCCCTTCAGCTCATGTATGAATTAATTAGCTATTTAAAACGATAATAATTCACACAAAAAAAAAAAAACAAAGTGAAAAATTCCCTTCGGCTATATGTTATT
CTTTTTTTGGGGTCAGAAATACATTAATATCTGGTTCCCTACTTACTATAATATATTACCACAATTTTTCCACAAAATATATTTAATTCCCTTCGGTGGTAAACCACCNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGGGGGGGGGGGATGATTATGGAAGCCTCTTAGGAAGATTAAAATACCCTTCCTTTACTAATTAATCTGATAATGCN
NNNNNNNNNNNNNNNNNNNNNNNNNNNGTTAAATGTATGTACGAATTAATAGATTTATTTTATACATTGAAAATGCAGGGTTGTGATGCATCAGTGCTCCTTGATGGTCCAAACTCAGAA
AAAACTGCACCACAAAATTATGGGCTTGGAGGGTTTGTTTTCATCGACAAGGTCAAAAGTGTTCTTGAACAACGTTGCCCTGGTGTGGTCTCTTGTGCTGATATTCTCAACCTTGCCGCT
AGAGATGCCGTTCATTTG
GTACCACTCTGACCTCCTATAATTTTTGGTCCTGTAGTTTGCAGATTTTATCATTTTGATCCTTGTAAGTTTTAAATTCAAGCGATTCGAGAATATGTTATA
AATTCTGTGATAAATTCTATTATATCTCATTATCAAAATGTAACGAAATTGGAAAATATTTCAGAATTTGTAACGTGTCTTTAAATTGCTCATGATTTAAGACTACATGAATAAAATTGA
TAGAAATGAAACTACATGGTTCATATTGTAGGCAAACCGTATAGACTAAAAGTGACTTGCTATTAAAACTAATATTTATCAAAATTCAAAGCACTAAGTTTTTATTGTATTTATTAATCT
TCAATAGGCAGGCGCACCATCTTATCCTGTTCTTACGGGAAGAAGAGACGGCCTGACATCTAGCAAATCATCCGTGGATCTTCCCTCACCGTCCATCTCATGGCAGGCTGCGCTCACATA
CTTCAAATCTAGGGGCTTGGATGTATTGGATATGACCACTCTCCTCG
GTAAGAAACAGAAATTACGAAAATGAGTTTCACCAGTCCATTTTATACATCCAAGTCCGGCCCACTTTTTTGT
TTTATGTTTTTTACTTTTTGAGTACAAGCGCTAATCTAAACAAGGAAAGAGGGTTTCTCACACACACTACAGCAGTGCCATAGGGTTTGAAACTTGAAATCACTAGTCAACAGTCAATGT
ATTTTTCCACTCTGCTAGACAAATTGGTTGATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATAAAATTGCTTTGAACACAGACAGGGTGGCATGATTGAACAACTGTTGAAGCGA
AACCCTTGCTAAGATTTAGTGGCTTGTAATGCGTGTTGTATTTTAACCGGCAATGTCTACTACTCATCATGTCACATGGCATTCCATTAAGTTACAGGCTTAAGTTTTTTCTCGATTTAG
CGCGAATAGGGTTGAACCCTCCACACGGGAATTAGGATTTAGGGTTTAGGGCAGTTTGGTTAATGGTTGCTTAAAAACTTGTAGCGAATGATATATGGACTTGAAAATTGAAGGTCCGAA
AGCAATTGACTTTGAAGCTGCAAAAGCCTGGTTTTTCTGGGTTTCTACCTTTAAAATGCATTTCTGATGGTTTCTCTTTGTCAGGCGCACATTCAATGGGCAAAACACATTGTCGTTACA
TTGTTGATCGGCTGTACAATTTCAATAACACGGGAAAGCCAGACCCAAGCATGGAACGTTCATTCATATCCGACATGAGAAAGCTTTGCCCGCCGAGAACAAAGAAGGGGCAGAGCGACC
CGCTGGTGTATCTAAACCCGGGGTTCGGCGCAAACCACACATTCACAGAATCGTACTACTCTAGAGTCCTATCTCACAAAGCTGTACTTGGAATTGATCAACAGCTACTGTATGGTGATG
ACACTAAGGAAATTACCAAAGAGTTTGCTGCCGGTTTTGAGGACTTTCGGAAGTCATTTGCTCTATCAATAAACCGGATGGGAGCTTACCAGGTTTTGACAGGAAACCAGGGAGAGATAC
GAAAAAATTGCCGAATTCCAAATAAGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATGAGAAGCCAAATATCATTTGTGTTTCTTGTTCTCCCATGTTTGGGTCTAGTTACTCTGAGCTTGTGTCTAGGGTTTGTGAGTGCTGCTTCTTCGTTGCCACAGCCTAACAAG
TTGACTTGGCATTATTACAAAATCCATAATACTTGTCATGAAGCAGAGATTTATGTAAGGCACCAAGTGCAGTTGCTTTGGAACAAGGATAAAACCATCACCCCCAAGCTCCTCAGGTTG
CTCTACTCCGATTGCTTCGTCACG
GGTTGTGATGCATCAGTGCTCCTTGATGGTCCAAACTCAGAAAAAACTGCACCACAAAATTATGGGCTTGGAGGGTTTGTTTTCATCGACAAGGTC
AAAAGTGTTCTTGAACAACGTTGCCCTGGTGTGGTCTCTTGTGCTGATATTCTCAACCTTGCCGCTAGAGATGCCGTTCATTTG
GCAGGCGCACCATCTTATCCTGTTCTTACGGGAAGA
AGAGACGGCCTGACATCTAGCAAATCATCCGTGGATCTTCCCTCACCGTCCATCTCATGGCAGGCTGCGCTCACATACTTCAAATCTAGGGGCTTGGATGTATTGGATATGACCACTCTC
CTCG
GCGCACATTCAATGGGCAAAACACATTGTCGTTACATTGTTGATCGGCTGTACAATTTCAATAACACGGGAAAGCCAGACCCAAGCATGGAACGTTCATTCATATCCGACATGAGA
AAGCTTTGCCCGCCGAGAACAAAGAAGGGGCAGAGCGACCCGCTGGTGTATCTAAACCCGGGGTTCGGCGCAAACCACACATTCACAGAATCGTACTACTCTAGAGTCCTATCTCACAAA
GCTGTACTTGGAATTGATCAACAGCTACTGTATGGTGATGACACTAAGGAAATTACCAAAGAGTTTGCTGCCGGTTTTGAGGACTTTCGGAAGTCATTTGCTCTATCAATAAACCGGATG
GGAGCTTACCAGGTTTTGACAGGAAACCAGGGAGAGATACGAAAAAATTGCCGAATTCCAAATAAGAAG

Retrieve as FASTA