Entry information : PpePrx79 ( ppb006944m)
Entry ID 9319
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-22 (Christophe Dunand)
Peroxidase information: PpePrx79 ( ppb006944m)
Name (synonym) PpePrx79 ( ppb006944m)
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx79
start..stop
S start..stop
GrPrx41 484 5e-174 1..332 1..332
MePrx135 482 4e-173 15..332 12..328
CclPrx31 478 1e-171 1..332 1..328
CsPrx50 478 2e-171 1..332 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4249683..4249907 225 N° 2 4250062..4250244 183 N° 3 4250329..4250494 166 N° 4 4250587..4251008 422
join(4249683..4249907,4250062..4250244,4250329..4250494,4250587..4251008)


exon

Literature and cross-references PpePrx79 ( ppb006944m)
DNA ref. Phytozome 12:   scaffold_6 (4249683..4251008)
Protein sequence: PpePrx79 ( ppb006944m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (304)
PWM (Da):   %s   35547.01 (32309.3) Transmb domain:   %s   i13-35o
PI (pH):   %s   7.29 (5.70) Peptide Signal:   %s   cut: 29 range:29-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTRSSITFSRRYSLLMIMFFALCLVAKAQLSTDFYKATCPDLLKIVRREVLNAIKTEMRMAASLLRLHFHDCFVNGCDASLLLDVTDSEKAALPNLNSARGFEVVDRIKSSVESACSGVVSCADILAIAARDSVVLSGGTPWKVLLGRRDGLVANQTGANNGLPSPFETLDVIISKFATVGLDVKDVVSLSGGHTIGLAKCSTFSNRLFNFSGTGSPDSTLDQSMLTDLQNLCPLTGDGSNTAPFDRNSADLFDNHYFQNLINGKGLLGSDQILFSSDAAVTTNTKSLVLSYSSNSRLFLSDFADSMVKMGNISPLTGSAGEIRKNCRLVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAGGTCATCGATTACTTTTAGTCGTCGTTACTCTTTGTTAATGATCATGTTTTTCGCGTTGTGTCTGGTTGCGAAGGCACAGTTAAGTACAGATTTCTACAAGGCAACATGTCCT
GATCTTCTCAAAATTGTCCGGAGAGAGGTTCTGAATGCAATCAAGACTGAAATGCGAATGGCTGCTTCTTTGCTTCGGCTACACTTCCATGACTGCTTTGTCAAT
GTGAGTTTAAGGCCT
TAAGCATCATGCATTCCAATTTTAACTAGCAAGCATTTCCTGTGAGTTTTTAAGACCTCCCTGATGAGGCACCATATTATTCATGGTGTTAAAATAAACATATATAAATTAACTCCTTTC
CGTGCATATATACGTGTAGGGTTGTGATGCATCGCTACTACTGGATGTAACTGACAGTGAGAAGGCTGCCTTGCCCAATTTGAACTCAGCAAGAGGATTTGAAGTTGTGGACAGAATCAA
GAGCTCTGTGGAGAGTGCATGCAGTGGAGTTGTATCGTGTGCTGATATACTAGCCATAGCTGCCAGAGACTCTGTGGTCCTA
GTAAGTTCACACTTTTTGGGTTCATTTTATACGTATCT
AAGTACGTATTAATGAGATCAGAGACTAAACATGTTTATCTTGCAGAGTGGAGGAACTCCATGGAAAGTTCTACTGGGAAGAAGAGATGGATTGGTGGCAAATCAAACAGGAGCAAATAA
TGGACTTCCTTCTCCATTTGAAACTCTGGATGTGATCATTTCCAAGTTTGCCACTGTAGGCCTCGATGTCAAAGATGTTGTGTCCTTATCAG
GTACATACTAATATCTAATCTCCAATAC
AATCCACCAATTAACTCTCTAATGTCTTAATGGATTTAATTAATTCTGTGTTAACTTATTATAGGAGGTCATACAATTGGGTTGGCAAAGTGCAGCACTTTCAGCAACAGGCTTTTCAAC
TTCTCAGGAACAGGTAGTCCAGACAGCACATTGGATCAAAGCATGTTAACTGATCTACAAAACTTGTGTCCACTCACTGGTGATGGAAGCAACACCGCGCCGTTTGATCGAAACTCAGCC
GATCTTTTTGACAACCATTACTTTCAGAACTTGATTAATGGAAAGGGCCTTCTTGGTTCTGATCAAATTCTGTTTTCCAGTGATGCAGCTGTGACAACAAACACCAAAAGTTTGGTCCTA
AGCTATAGCTCTAATTCTAGGCTTTTCCTCAGTGATTTTGCTGATTCTATGGTCAAGATGGGGAATATAAGTCCTCTTACTGGGTCTGCTGGAGAGATCAGAAAGAACTGCCGGCTGGTT
AATTCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAGGTCATCGATTACTTTTAGTCGTCGTTACTCTTTGTTAATGATCATGTTTTTCGCGTTGTGTCTGGTTGCGAAGGCACAGTTAAGTACAGATTTCTACAAGGCAACATGTCCT
GATCTTCTCAAAATTGTCCGGAGAGAGGTTCTGAATGCAATCAAGACTGAAATGCGAATGGCTGCTTCTTTGCTTCGGCTACACTTCCATGACTGCTTTGTCAAT
GGTTGTGATGCATCG
CTACTACTGGATGTAACTGACAGTGAGAAGGCTGCCTTGCCCAATTTGAACTCAGCAAGAGGATTTGAAGTTGTGGACAGAATCAAGAGCTCTGTGGAGAGTGCATGCAGTGGAGTTGTA
TCGTGTGCTGATATACTAGCCATAGCTGCCAGAGACTCTGTGGTCCTA
AGTGGAGGAACTCCATGGAAAGTTCTACTGGGAAGAAGAGATGGATTGGTGGCAAATCAAACAGGAGCAAAT
AATGGACTTCCTTCTCCATTTGAAACTCTGGATGTGATCATTTCCAAGTTTGCCACTGTAGGCCTCGATGTCAAAGATGTTGTGTCCTTATCAG
GAGGTCATACAATTGGGTTGGCAAAG
TGCAGCACTTTCAGCAACAGGCTTTTCAACTTCTCAGGAACAGGTAGTCCAGACAGCACATTGGATCAAAGCATGTTAACTGATCTACAAAACTTGTGTCCACTCACTGGTGATGGAAGC
AACACCGCGCCGTTTGATCGAAACTCAGCCGATCTTTTTGACAACCATTACTTTCAGAACTTGATTAATGGAAAGGGCCTTCTTGGTTCTGATCAAATTCTGTTTTCCAGTGATGCAGCT
GTGACAACAAACACCAAAAGTTTGGTCCTAAGCTATAGCTCTAATTCTAGGCTTTTCCTCAGTGATTTTGCTGATTCTATGGTCAAGATGGGGAATATAAGTCCTCTTACTGGGTCTGCT
GGAGAGATCAGAAAGAACTGCCGGCTGGTTAATTCA

Retrieve as FASTA