Entry information : PpePrx01 (ppa007654m)
Entry ID 9321
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx01 (ppa007654m)
Name (synonym) PpePrx01 (ppa007654m)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx01
start..stop
S start..stop
PpePrx03 582 0 12..360 10..354
MdPrx08 567 0 1..360 1..350
PkPrx03 481 6e-172 23..358 10..345
PtPrx98 477 2e-170 22..358 10..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4267388..4267645 258 N° 2 4267936..4268139 204 N° 3 4268221..4268386 166 N° 4 4268493..4268944 452
join(4267388..4267645,4267936..4268139,4268221..4268386,4268493..4268944)


exon

Literature and cross-references PpePrx01 (ppa007654m)
DNA ref. Phytozome 12:   scaffold_6 (4267388..4268944)
Protein sequence: PpePrx01 (ppa007654m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (321)
PWM (Da):   %s   37927.62 (34046.7) Transmb domain:   %s   o15-37i
PI (pH):   %s   4.45 (4.43) Peptide Signal:   %s   cut: 40 range:40-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPPSSSSSASQNNCSIKISVSILFAILLILCAGAGYGEAQLTTTFYDEVCPCAITTVRGVILDALQTDPRIAASLTRLHFHDCFVNGCDGSILLDNSSSTSSTIDSEKAAFANNNSARGFDVVDNIKTALETACPGVVSCADILAIAAEESVSLSGGPSWTVLLGRRDSTTANRTAANEALPAPSFTLDELKASFAAVGLDTTDLVALSGAHTFGRAKCQSFSNRLYDFNSTGLPDPTLNSTYLETLRELCPQNGNASVLANFDPSTPNTFDGKYFSNLQVRKGLLQSDQELFSTSGADTINIVNNFSVNQSAFFESFVKSMIKMGNISPLTGTDGEIRLNCRRVNGDSYGSSATLIAE

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCCTTCTTCTTCTTCTTCTGCTTCTCAAAATAATTGCAGTATTAAAATATCGGTAAGTATTTTGTTTGCGATATTATTAATCTTGTGTGCAGGTGCAGGATATGGTGAGGCTCAG
CTGACCACTACGTTTTATGATGAAGTCTGCCCGTGCGCCATAACCACTGTGCGTGGTGTCATTCTAGACGCTTTGCAGACAGATCCCCGGATTGCTGCCAGCCTCACCAGGCTTCACTTC
CATGACTGCTTCGTCAAC
GTACATATTTCATCCCCTGCTCTTTTATTTTTACTTCTAAGTACATGTTCTTCTTCATGATCAAATGCTCCATTCATCTGAGGACTCAAACTGATGAGCTTA
GATTTAAGCTGAAGAACTTATTTAACTTAAAACAACTAATTTCGGAATTTGGACACCGACCGCGATTAATCATTCGAAAACGAACAAAATTTATCCTAACATGATTAAGCAACCACTTAG
ATATTTGAAAACATTGGTGAATATATTGTTGGGAAGATCACAAGACTTGTTGGTTGTATTAATTTCAGGGTTGTGATGGATCAATCTTGTTGGACAACAGTAGCAGCACTTCCAGTACCA
TAGACAGCGAGAAAGCAGCATTTGCAAATAACAACTCAGCCAGAGGATTTGATGTTGTGGACAACATCAAGACTGCATTGGAGACTGCTTGTCCCGGGGTTGTTTCCTGTGCTGACATTC
TCGCCATTGCAGCTGAAGAATCTGTTTCTTTG
GTACATATTTCAAAAACAATTTATGCCTTCATCTTGTTCTTCTATATCGATCTCTTCTTGAAATTAATTTTATGGTTGCAGTCTGGAG
GCCCCTCGTGGACAGTTCTATTAGGAAGAAGGGATAGCACAACAGCGAATCGCACGGCTGCCAATGAAGCCCTTCCAGCTCCCTCTTTCACCCTTGACGAACTCAAGGCCAGCTTCGCAG
CTGTAGGCCTCGACACCACTGATCTGGTTGCACTATCCG
GTAAGTAAGAAAAGAAAAAAAAACATTTGAAGGAACTATATACATATGTGTGTTGCTTTTTAGTGACAACATTTGACATGC
ATATGATATAATATATAATTCACAGGTGCTCACACATTTGGGCGTGCTAAATGTCAATCTTTCAGCAATCGACTGTATGACTTCAACAGCACAGGCCTTCCTGATCCGACCTTAAACTCA
ACCTACTTAGAAACACTAAGAGAGTTATGCCCCCAGAACGGGAATGCGAGTGTGCTAGCTAACTTTGATCCTTCAACACCTAACACTTTCGACGGCAAGTATTTCTCTAATCTTCAAGTT
CGTAAGGGCCTTCTCCAAAGCGATCAAGAGCTGTTTTCGACCAGCGGGGCTGATACGATCAACATTGTTAACAACTTCAGCGTTAATCAGAGCGCCTTCTTTGAGAGCTTTGTGAAATCC
ATGATTAAAATGGGGAATATAAGCCCTCTGACCGGAACTGATGGAGAGATTCGATTGAATTGCAGGAGGGTTAATGGAGATTCGTATGGATCATCTGCTACTTTGATAGCGGAGTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCCTTCTTCTTCTTCTTCTGCTTCTCAAAATAATTGCAGTATTAAAATATCGGTAAGTATTTTGTTTGCGATATTATTAATCTTGTGTGCAGGTGCAGGATATGGTGAGGCTCAG
CTGACCACTACGTTTTATGATGAAGTCTGCCCGTGCGCCATAACCACTGTGCGTGGTGTCATTCTAGACGCTTTGCAGACAGATCCCCGGATTGCTGCCAGCCTCACCAGGCTTCACTTC
CATGACTGCTTCGTCAAC
GGTTGTGATGGATCAATCTTGTTGGACAACAGTAGCAGCACTTCCAGTACCATAGACAGCGAGAAAGCAGCATTTGCAAATAACAACTCAGCCAGAGGATTT
GATGTTGTGGACAACATCAAGACTGCATTGGAGACTGCTTGTCCCGGGGTTGTTTCCTGTGCTGACATTCTCGCCATTGCAGCTGAAGAATCTGTTTCTTTG
TCTGGAGGCCCCTCGTGG
ACAGTTCTATTAGGAAGAAGGGATAGCACAACAGCGAATCGCACGGCTGCCAATGAAGCCCTTCCAGCTCCCTCTTTCACCCTTGACGAACTCAAGGCCAGCTTCGCAGCTGTAGGCCTC
GACACCACTGATCTGGTTGCACTATCCG
GTGCTCACACATTTGGGCGTGCTAAATGTCAATCTTTCAGCAATCGACTGTATGACTTCAACAGCACAGGCCTTCCTGATCCGACCTTAAAC
TCAACCTACTTAGAAACACTAAGAGAGTTATGCCCCCAGAACGGGAATGCGAGTGTGCTAGCTAACTTTGATCCTTCAACACCTAACACTTTCGACGGCAAGTATTTCTCTAATCTTCAA
GTTCGTAAGGGCCTTCTCCAAAGCGATCAAGAGCTGTTTTCGACCAGCGGGGCTGATACGATCAACATTGTTAACAACTTCAGCGTTAATCAGAGCGCCTTCTTTGAGAGCTTTGTGAAA
TCCATGATTAAAATGGGGAATATAAGCCCTCTGACCGGAACTGATGGAGAGATTCGATTGAATTGCAGGAGGGTTAATGGAGATTCGTATGGATCATCTGCTACTTTGATAGCGGAGTAT

Retrieve as FASTA