Entry information : PpePrx03 (ppa007826m)
Entry ID 9323
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx03 (ppa007826m)
Name (synonym) PpePrx03 (ppa007826m)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx03
start..stop
S start..stop
PpePrx01 577 0 10..354 12..360
MdPrx08 548 0 12..354 4..350
PkPrx03 473 7e-169 15..352 5..345
PtPrx98 469 3e-167 15..352 5..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4283935..4284186 252 N° 2 4284300..4284491 192 N° 3 4284584..4284749 166 N° 4 4284857..4285308 452
join(4283935..4284186,4284300..4284491,4284584..4284749,4284857..4285308)


exon

Literature and cross-references PpePrx03 (ppa007826m)
DNA ref. Phytozome 12:   scaffold_6 (4283935..4285308)
Protein sequence: PpePrx03 (ppa007826m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354 (317)
PWM (Da):   %s   37201.04 (33473.2) Transmb domain:   %s   i12-34o
PI (pH):   %s   3.98 (3.96) Peptide Signal:   %s   cut: 38 range:38-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSSSSSSPNNYSTKILASILFAILLILCAGAGYGEAQLSPTFYDKDCPNATSIVRAVIEEALQTDLRIAASLTRLFFHDCFVNGCDGSILLDNSSTIDSEKGALPNNNSARGFDVVDNIKTALETACPGIVSCADILAISAEESVSLSGGPSWTVLLGRRDSTTANRTAANEALPAPSFTLDELKASFAAVGLDTTDLVALSGAHTFGRAQCQFFSDRLYAFNSTGSPDPTLNSTYLETLSALCPQSGNGSVLADLDPSTPDGFDADYFSNLQVHYGLLQSDQELFSTSGADTVDIINSYSANQSAFFESFVISMNKMGNISLLTGTDGEIRLNCSKVNEDTYGSSATLIAE

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCTTCTTCTTCTTCTTCTCCAAATAATTACAGTACTAAAATATTGGCAAGTATTTTGTTTGCCATATTATTAATCTTGTGTGCAGGTGCAGGATATGGTGAGGCCCAGCTGAGC
CCTACGTTTTACGATAAAGACTGCCCAAATGCCACAAGTATTGTGCGTGCTGTCATTGAAGAGGCTTTGCAGACAGATCTCCGTATTGCTGCCAGCCTCACCAGGCTTTTCTTCCATGAC
TGCTTCGTCAAC
GTACATATACATATACTTTATTACATTATACATGCATATGCACGCATATCTATATGCATCAAAAATCCTCTTACGTACATATATATGGCCTGATATAATCTATTTAAT
TTCAGGGTTGTGATGGATCAATCTTGTTGGACAACAGTAGTACCATAGACAGCGAGAAAGGAGCATTGCCAAATAACAACTCAGCCAGAGGATTTGATGTTGTGGACAACATCAAGACTG
CTTTGGAGACTGCTTGCCCCGGCATTGTTTCCTGTGCTGATATTCTCGCCATTTCTGCTGAAGAATCTGTTTCTTTG
GTACATATATATATGTCAACAACANNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNCCGATCTCTTCTTGAAATTAATTTTATGGTTGCAGTCTGGAGGCCCCTCATGGACAGTTCTATTAGGAAGAAGGGATAGCACAACAGCGAATCGCACGGCTGCCAA
CGAAGCCCTTCCAGCTCCCTCTTTCACCCTTGACGAACTCAAGGCCAGCTTCGCAGCTGTTGGCCTCGACACCACTGATCTGGTTGCACTATCCG
GTAAGTAAGGAAGGAAAGAAAAAAA
AAATGGACATATTAATATACGTACGTGTGTGTGTGTCTATGTTGCTCTTTAGTGACAACATTTGACATGCATAACATAACAGGTGCTCACACATTTGGGCGTGCTCAATGTCAATTTTTC
TCCGACCGATTGTATGCCTTCAACAGCACAGGCAGTCCTGATCCAACCTTAAACTCAACCTACTTAGAAACACTGAGTGCGTTATGCCCGCAGTCCGGGAATGGGAGTGTGCTAGCCGAT
CTCGACCCTTCAACTCCTGATGGTTTCGATGCCGATTATTTCTCTAATCTTCAAGTTCATTATGGCCTTCTCCAAAGCGATCAAGAGCTGTTTTCGACCAGCGGGGCTGATACCGTTGAC
ATTATTAACAGCTACAGCGCTAATCAAAGCGCCTTCTTTGAGAGCTTTGTGATATCTATGAATAAAATGGGGAATATAAGCCTCCTGACCGGAACTGATGGAGAGATTCGATTGAACTGC
AGTAAGGTTAATGAAGATACATATGGATCATCTGCTACTTTGATAGCTGAGTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCTTCTTCTTCTTCTTCTCCAAATAATTACAGTACTAAAATATTGGCAAGTATTTTGTTTGCCATATTATTAATCTTGTGTGCAGGTGCAGGATATGGTGAGGCCCAGCTGAGC
CCTACGTTTTACGATAAAGACTGCCCAAATGCCACAAGTATTGTGCGTGCTGTCATTGAAGAGGCTTTGCAGACAGATCTCCGTATTGCTGCCAGCCTCACCAGGCTTTTCTTCCATGAC
TGCTTCGTCAAC
GGTTGTGATGGATCAATCTTGTTGGACAACAGTAGTACCATAGACAGCGAGAAAGGAGCATTGCCAAATAACAACTCAGCCAGAGGATTTGATGTTGTGGACAACATC
AAGACTGCTTTGGAGACTGCTTGCCCCGGCATTGTTTCCTGTGCTGATATTCTCGCCATTTCTGCTGAAGAATCTGTTTCTTTG
TCTGGAGGCCCCTCATGGACAGTTCTATTAGGAAGA
AGGGATAGCACAACAGCGAATCGCACGGCTGCCAACGAAGCCCTTCCAGCTCCCTCTTTCACCCTTGACGAACTCAAGGCCAGCTTCGCAGCTGTTGGCCTCGACACCACTGATCTGGTT
GCACTATCCG
GTGCTCACACATTTGGGCGTGCTCAATGTCAATTTTTCTCCGACCGATTGTATGCCTTCAACAGCACAGGCAGTCCTGATCCAACCTTAAACTCAACCTACTTAGAAACA
CTGAGTGCGTTATGCCCGCAGTCCGGGAATGGGAGTGTGCTAGCCGATCTCGACCCTTCAACTCCTGATGGTTTCGATGCCGATTATTTCTCTAATCTTCAAGTTCATTATGGCCTTCTC
CAAAGCGATCAAGAGCTGTTTTCGACCAGCGGGGCTGATACCGTTGACATTATTAACAGCTACAGCGCTAATCAAAGCGCCTTCTTTGAGAGCTTTGTGATATCTATGAATAAAATGGGG
AATATAAGCCTCCTGACCGGAACTGATGGAGAGATTCGATTGAACTGCAGTAAGGTTAATGAAGATACATATGGATCATCTGCTACTTTGATAGCTGAGTAT

Retrieve as FASTA