Entry information : PpePrx04 (ppa007961m)
Entry ID 9324
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx04 (ppa007961m)
Name (synonym) PpePrx04 (ppa007961m)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx04
start..stop
S start..stop
PpePrx50 663 0 2..349 10..344
RcPrx72 466 6e-166 2..348 26..350
VvPrx90 464 4e-165 2..347 47..370
CsPrx17 462 5e-164 1..349 41..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6603044..6603187 144 N° 2 6602099..6602296 198 N° 3 6601577..6601742 166 N° 4 6600905..6601446 542
complement(join(6600905..6601446,6601577..6601742,6602099..6602296,6603044..6603 187))


exon

Literature and cross-references PpePrx04 (ppa007961m)
DNA ref. Phytozome 12:   scaffold_7 (6603187..6600905)
Protein sequence: PpePrx04 (ppa007961m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350
PWM (Da):   %s   38299.62  
PI (pH):   %s   6.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNIEYDFYRDTCPEAETIVSSTMAQIYSQHKNVSAQLLRLFFHDCFIQGCDASVLLDDSNGNKNHSIEKQAVPNKTLKGFDKIYQIKEVLENVCPGVVSCADILALATRDGVVLAGGPFYPLFTGRRDSARSYYDEATAEIPKPDDNITQTLHLFSLRGFTDRETVSLLGGHNIGKIGCEFIQSRLHNFKGTGKTDPTVSPSFLNEMRVFCEDNGNEKSSQGSPMAATMASPMAFPTAGPMASSPMASRGMSEKPAPRGMPYFQQLSSSVSSGAGFDTHYYQSLLRGRGLLFADQQLMANERTARLVRAYASDDGSTFRMDFARAMMKMSNLNPLTGSQGQVRLECTLA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACATTGAGTACGATTTCTACCGCGATACATGCCCTGAAGCTGAGACCATTGTAAGTTCTACGATGGCTCAGATTTACTCCCAGCACAAGAATGTCTCTGCTCAGCTTCTTCGCCTC
TTTTTCCATGATTGCTTCATTCAG
GTATACGAAGATTCTTCTTTTATTCATATTTGAGGCTTTTTATCAAGTAGGTTTCGTTCTGATTACTCTGGGTTCTCTGCTTTTAATCTTGATTGT
AGTTTTCTGCATCTGTGTGGGTTTCTCTCAAATGGGTTTTGTTTTGATTGCTCTTGATTTCCTGCTTCTAGTCTTTATGGTTCTGTTCTTCATCTATGAATGGGTATTGTTTGGATAGCT
CTGGGGTTTTCTGCGTTTAATCTTGGTCGTCCTTTTCTTCGCCTGTGTGGGTTTCTCTCAAATGGGTTTTGCTTGCTCAGGGGATTGGAATCTGCGAATCTTGAAACTTTGTGATTTTCA
ATTTATGTTGGTGAGGTATATGATTTTTTTGTGTGTTTCTCAATTTGATGTTGTTATTGGTTTCTATGAGTCTTGAAACACTGGGTTGTTCAATCTGACGTAAAAGTACGGTTTTCTGGT
TCGAGTTGTTCTTTTATGATTTTTAACACTTGAGAATCTGAAAATTCTTATCTGGGAATGTTAAAGCTACAATGCTGGACATTTAGTTTACGATGATTTGGGCATGATATTTATGAGTTT
TTCTGGAATGGGTTTTCGTTTCTTCGAGTCTTTTGGCTCTAACCTTAGTTGGGCTATAATATTCCCTTTCTTCTTGTAAGGTGGTTTCTTTCTTTTTAATCAAGCATGTATTACTTGGAT
TTCTGTCTAATTCCATCTGTCTTTCTTAATGTTGTGGGGTTTTTGAATCAGGGTTGCGATGCTTCAGTCCTCTTGGATGACAGCAATGGGAATAAAAACCATTCCATAGAGAAGCAGGCT
GTGCCAAATAAGACCTTGAAAGGATTTGATAAAATTTATCAGATCAAGGAGGTGCTTGAAAATGTTTGCCCAGGGGTGGTATCTTGTGCTGACATACTTGCTCTTGCCACCAGAGATGGC
GTTGTTCTG
GTATGTTTTACTGCTCCTCTGAGTCTTGACGTATTCTTTCCTGTTTTGATTTTCAGAGTTCGATCGTTACTGGGCAATGTATATATGTATCTAAAACAACCTCTAAGGCAA
AAATTTCCAGTTTCTTTCTCTTTCCATCTAATTACCATTAGAAAACCGAACTAAAAGAGAGAAGTAAAAAACCAAAACTATCACAAATTTAGTTGTTCAACCTTGCCAACATTTAGTAGT
CCTCCTCGGTACTTAAGTGGAAAAGCTACAGAGCACTTCACGAGATTATCTGATTGCTTGTTTCAGTATTTCCCTGCACTTTTAGCTGTCTTGTTCCCTGAGTGTTTTCCTATCTAAAAT
GACAGGCTGGTGGTCCCTTTTATCCACTTTTCACTGGTAGAAGAGATAGTGCCCGCTCCTACTATGATGAAGCCACGGCTGAGATTCCAAAACCTGATGATAATATCACTCAGACACTTC
ATCTGTTCTCACTCAGAGGTTTTACTGACAGAGAAACCGTCAGTCTTCTAG
GTACTCAACTAACAAATTCTGTTCCTTCTTTTTCTTCTTTTCTTTATGTTTGGAGCTGAAATAGATTAA
TCAGTCTTGACATATTCTTTCCTTCTGATTTTTTTGTTTTTGTTTTGTTTCATATCTGTAGGAGGGCACAACATTGGGAAGATTGGATGTGAGTTCATTCAGTCTCGCCTTCACAACTTC
AAGGGGACAGGGAAAACAGACCCAACTGTTTCTCCTAGTTTCCTCAATGAGATGAGAGTTTTCTGTGAAGACAATGGTAATGAGAAGAGTAGCCAAGGATCACCAATGGCAGCTACCATG
GCGTCTCCCATGGCATTCCCCACGGCAGGCCCCATGGCATCATCCCCAATGGCATCAAGGGGCATGAGTGAGAAGCCTGCGCCGAGGGGGATGCCATACTTTCAGCAACTGTCATCATCT
GTATCGTCTGGGGCAGGCTTTGACACTCATTACTACCAGAGCTTGTTGAGAGGCAGAGGACTTCTCTTTGCTGATCAGCAATTGATGGCTAATGAGAGGACAGCCAGATTGGTGAGAGCT
TATGCTTCAGACGATGGATCAACCTTCCGGATGGACTTTGCCCGGGCAATGATGAAGATGTCTAACCTTAATCCACTCACTGGATCTCAAGGTCAGGTCCGATTAGAATGCACTCTAGCT
AGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACATTGAGTACGATTTCTACCGCGATACATGCCCTGAAGCTGAGACCATTGTAAGTTCTACGATGGCTCAGATTTACTCCCAGCACAAGAATGTCTCTGCTCAGCTTCTTCGCCTC
TTTTTCCATGATTGCTTCATTCAG
GGTTGCGATGCTTCAGTCCTCTTGGATGACAGCAATGGGAATAAAAACCATTCCATAGAGAAGCAGGCTGTGCCAAATAAGACCTTGAAAGGATTT
GATAAAATTTATCAGATCAAGGAGGTGCTTGAAAATGTTTGCCCAGGGGTGGTATCTTGTGCTGACATACTTGCTCTTGCCACCAGAGATGGCGTTGTTCTG
GCTGGTGGTCCCTTTTAT
CCACTTTTCACTGGTAGAAGAGATAGTGCCCGCTCCTACTATGATGAAGCCACGGCTGAGATTCCAAAACCTGATGATAATATCACTCAGACACTTCATCTGTTCTCACTCAGAGGTTTT
ACTGACAGAGAAACCGTCAGTCTTCTAG
GAGGGCACAACATTGGGAAGATTGGATGTGAGTTCATTCAGTCTCGCCTTCACAACTTCAAGGGGACAGGGAAAACAGACCCAACTGTTTCT
CCTAGTTTCCTCAATGAGATGAGAGTTTTCTGTGAAGACAATGGTAATGAGAAGAGTAGCCAAGGATCACCAATGGCAGCTACCATGGCGTCTCCCATGGCATTCCCCACGGCAGGCCCC
ATGGCATCATCCCCAATGGCATCAAGGGGCATGAGTGAGAAGCCTGCGCCGAGGGGGATGCCATACTTTCAGCAACTGTCATCATCTGTATCGTCTGGGGCAGGCTTTGACACTCATTAC
TACCAGAGCTTGTTGAGAGGCAGAGGACTTCTCTTTGCTGATCAGCAATTGATGGCTAATGAGAGGACAGCCAGATTGGTGAGAGCTTATGCTTCAGACGATGGATCAACCTTCCGGATG
GACTTTGCCCGGGCAATGATGAAGATGTCTAACCTTAATCCACTCACTGGATCTCAAGGTCAGGTCCGATTAGAATGCACTCTAGCTAGC

Retrieve as FASTA