Entry information : PpePrx05 (ppa008309m)
Entry ID 9325
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2016-01-08 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-08 (Achraf Jemmat)
Peroxidase information: PpePrx05 (ppa008309m)
Name (synonym) PpePrx05 (ppa008309m)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx05
start..stop
S start..stop
CclPrx118 456 1e-162 1..339 1..335
GmPrx164 453 1e-161 3..339 1..332
CsPrx45 452 2e-161 11..339 1..324
PtPrx17 453 2e-161 1..339 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8637192..8637452 261 N° 2 8636890..8637081 192 N° 3 8636635..8636800 166 N° 4 8636148..8636545 398
complement(join(8636148..8636545,8636635..8636800,8636890..8637081,8637192..8637 452))


exon

Literature and cross-references PpePrx05 (ppa008309m)
DNA ref. Phytozome 12:   scaffold_1 (8637452..8636148)
EST ref. GenBank:   GR410556.1 [3' end]
Protein sequence: PpePrx05 (ppa008309m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (312)
PWM (Da):   %s   36390.14 (33539.4)  
PI (pH):   %s   4.38 (4.24) Peptide Signal:   %s   cut: 28 range:28-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMKKLALFSLLLNLAIVLAIVPKTTGEGYGGGGDDECGDLLGSDLYKDICPEAEAIIFARVRLAVFQDTRMAASLLRLHFHDCFVNGCDASVLLDDTDNFVGEKTAAPNLNSLRGFEVIDAIKQELEFVCPQTVSCADILATAARDSVVVSGGPSWDVQMGRKDSLTASKALANNIIPGPNSTIGNLVAKFQNVNLSLKDMVALSGAHTMGKARCTTFAARLQDSTNPNTPEASLEFIQSLQQLCSVSDSSTLANLDLATPETFDNQYYVNLLSGEGLLPSDQNLVTGDEQTRELVETYAQDMSTFFQDFKDSMITLGRLGPFTGTKGEIRRNCRSV

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (splicing error of exon1/intron1 due to GC => confirmed with 1 EST)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGAAGAAGTTGGCCTTGTTTTCACTATTGCTGAACCTTGCAATTGTTCTTGCAATCGTTCCGAAAACCACGGGTGAAGGATATGGTGGTGGTGGTGATGATGAATGTGGAGAC
CTCTTGGGGAGTGATTTGTACAAAGATATCTGCCCTGAGGCAGAGGCCATAATATTTGCTCGGGTCAGATTGGCAGTGTTTCAGGACACGAGAATGGCAGCCTCTCTGCTTCGTCTCCAT
TTCCATGACTGCTTTGTTAAT
GCACGTTATCTCTTGTTTGCACTGTTTATATATGTGTTATGTTGTTATTATTATTATTTGAATGAGCNNNNNNNNNNNNNNNNNNNNNNGTTGTGTGCT
GAATTGTGCAGGGGTGTGACGCTTCTGTGTTACTAGATGACACTGACAACTTTGTTGGTGAGAAAACTGCAGCACCAAACTTGAACTCTCTGAGAGGTTTTGAAGTGATTGATGCGATAA
AACAGGAACTTGAATTTGTTTGCCCTCAAACAGTTTCCTGTGCTGACATTCTTGCAACTGCTGCCAGAGACTCTGTTGTTGTG
GTGTGTGCTCTGAGAGTTTAGAATTTAGATATTCTTG
CAACCGCTGTTAACATGGGATTCTGACTAATAATTTGAACTTCAATTTGCAGTCCGGTGGACCAAGCTGGGATGTCCAAATGGGAAGGAAGGACAGCTTGACTGCTAGCAAAGCACTAGC
AAATAACATCATCCCAGGCCCGAATTCTACCATTGGAAACCTGGTTGCCAAGTTCCAGAACGTAAACCTTAGCTTGAAGGACATGGTTGCACTCTCTG
GTACTCTCAACTTTCCTTTATT
GATCTCTTGTATTGTTCTTGATTGGAAAACAAAACAAGATCACCATTTTGCTCTTCTTGTTTGGCAGGTGCACACACAATGGGGAAAGCCCGGTGCACCACCTTTGCTGCTCGCCTACAA
GACTCCACCAACCCAAATACCCCTGAGGCGTCTCTGGAGTTCATTCAGTCACTGCAGCAGCTATGCTCAGTATCCGACAGCAGCACACTGGCAAACCTTGACCTGGCAACCCCAGAAACG
TTTGATAACCAATACTACGTTAACCTACTTTCTGGGGAGGGTTTGCTTCCATCCGATCAGAATCTCGTGACCGGAGATGAGCAAACACGTGAATTGGTAGAGACCTATGCACAGGACATG
TCTACCTTCTTCCAAGACTTTAAAGATTCTATGATCACACTGGGAAGGTTGGGACCATTTACTGGGACGAAGGGAGAGATTCGTCGGAACTGTCGAAGTGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGAAGAAGTTGGCCTTGTTTTCACTATTGCTGAACCTTGCAATTGTTCTTGCAATCGTTCCGAAAACCACGGGTGAAGGATATGGTGGTGGTGGTGATGATGAATGTGGAGAC
CTCTTGGGGAGTGATTTGTACAAAGATATCTGCCCTGAGGCAGAGGCCATAATATTTGCTCGGGTCAGATTGGCAGTGTTTCAGGACACGAGAATGGCAGCCTCTCTGCTTCGTCTCCAT
TTCCATGACTGCTTTGTTAAT
GGGTGTGACGCTTCTGTGTTACTAGATGACACTGACAACTTTGTTGGTGAGAAAACTGCAGCACCAAACTTGAACTCTCTGAGAGGTTTTGAAGTGATT
GATGCGATAAAACAGGAACTTGAATTTGTTTGCCCTCAAACAGTTTCCTGTGCTGACATTCTTGCAACTGCTGCCAGAGACTCTGTTGTTGTG
TCCGGTGGACCAAGCTGGGATGTCCAA
ATGGGAAGGAAGGACAGCTTGACTGCTAGCAAAGCACTAGCAAATAACATCATCCCAGGCCCGAATTCTACCATTGGAAACCTGGTTGCCAAGTTCCAGAACGTAAACCTTAGCTTGAAG
GACATGGTTGCACTCTCTG
GTGCACACACAATGGGGAAAGCCCGGTGCACCACCTTTGCTGCTCGCCTACAAGACTCCACCAACCCAAATACCCCTGAGGCGTCTCTGGAGTTCATTCAG
TCACTGCAGCAGCTATGCTCAGTATCCGACAGCAGCACACTGGCAAACCTTGACCTGGCAACCCCAGAAACGTTTGATAACCAATACTACGTTAACCTACTTTCTGGGGAGGGTTTGCTT
CCATCCGATCAGAATCTCGTGACCGGAGATGAGCAAACACGTGAATTGGTAGAGACCTATGCACAGGACATGTCTACCTTCTTCCAAGACTTTAAAGATTCTATGATCACACTGGGAAGG
TTGGGACCATTTACTGGGACGAAGGGAGAGATTCGTCGGAACTGTCGAAGTGTCAAT

Retrieve as FASTA