Entry information : RcAPx05 (29656.m000477)
Entry ID 9331
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: RcAPx05 (29656.m000477)
Name (synonym) RcAPx05 (29656.m000477)
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcAPx05
start..stop
S start..stop
MeAPx09 409 4e-146 1..281 6..279
LeAPx06 379 5e-134 1..281 6..285
CclAPx06 376 8e-133 1..281 7..286
HaAPx06 376 1e-132 1..279 8..284
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38326..38423 98 N° 2 38536..38660 125 N° 3 38774..38823 50 N° 4 39118..39183 66
N° 5 39264..39335 72 N° 6 39417..39455 39 N° 7 39486..39594 109 N° 8 39698..39797 100
N° 9 39878..40063 186  
join(38326..38423,38536..38660,38774..38823,39118..39183,39264..39335,39417..394 55,39486..39594,39698..39797,39878..40063)


exon

Literature and cross-references RcAPx05 (29656.m000477)
DNA ref. Phytozome 12:   29656 (38326..40063)
Protein sequence: RcAPx05 (29656.m000477)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   282
PWM (Da):   %s   29961.34 Transmb domain:   %s   o255-277i
PI (pH):   %s   6.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDAEYLKEIEKARRDLRALISSKSCAPIMLRLAWHDAGTYDAKTKTGGPNGSIRNEIEYKHEANNGLKIAIDLCEDIKARHPKISYADLYQLAGVVSVEITGGPTIEFVPGRKDSTQSPEEGRLPDSRxxxxxxxxxYIGKFVRDESIIELxCDSHLVLQGKAHRERSGFEGAWTKDPLKFDNSYFKKLLGGDSGLLKLPTDKALVEDPIFRQYVERYAGDEDAFFADYAASHKKLSELGFTPPARGTLATKCCTLFAQGAVGVALAAALVVLGYYYEAHRN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Gap in frame due to the 'NNNNNN' in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATGCAGAGTACTTAAAGGAGATAGAGAAGGCTCGTAGAGACCTTCGCGCACTCATTTCCAGCAAAAGCTGTGCTCCTATCATGCTTCGTCTTGCGTAAAATGCCATATTCTTTTCT
TCTTTTTCGAAAAAAGAAACTCGAACTCGAAACCCCTTACAGTCTTCCGATGCGACTTTTGAGGATCATTAACAGTTGTGTTGTGTGCAGGTGGCATGATGCAGGGACTTATGATGCGAA
AACGAAGACAGGAGGACCTAATGGTTCTATTAGGAATGAGATAGAGTACAAGCATGAAGCTAATAATGGTCTTAAAATTGCCATTGATTTATGCG
GTCTGCCTCTCTTCCTTTTTTTTTT
TCGTTTGGTTGTGATATCTGAACTGAACCTTTTTGTTTGTATAAAGAAAACAAGAAATTGTCTAATTGCCTTTTTTTCTTCATTTTAGAGGATATCAAGGCTAGACATCCCAAAATTTCA
TATGCTGACCTCTATCAG
GTGATCCTTTGTGTTTCCAGATTGTTTCTATATTAGCAGTATGATCTACAATGGTTGAAGTGTTTTTCCCTTTTTTCTTTTCTTGGTTAATTAATATGCTTG
GCAGTTATGTCGGTTTGAGATTGTTTAAAGGGTTTCCCTGTTCTTGAATAACCATCTAACCCTTAACATATTTACTACAAGTACCATAAAATCTATGTCACATTAACAAAGCCATACCAC
TAAATATAGCAAAGTAATTATCTAATGTTTAACTTATTCTCAAGAAGCTCAGCTTTTTCGGCTTTCTATCAGCTTGCTGGGGTTGTTTCTGTTGAGATCACAGGAGGTCCGACCATTGAA
TTTGTTCCAGGCAGAAAG
GTATGCTTATGGGAGAATGTGTTACTTGTCAAGCGCCTAGAAGGGTTCATGTACAGTAACTTCCTTTTCTTCTGTATCAGGATTCAACTCAATCTCCTGAAG
AGGGGCGTCTTCCTGACTCCAGAANNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNTGGTGGTCATACATTGGTAAATTTGTCAGAGATGAAAGTATCATAGAAGTTTTAGTTCAAGATTCAAAAAAACTCTAGCTTGANTGTGATTCTCACTTGGTTTTGCAGGGAAAGGCAC
ATAGGGAAAGATCAGGCTTTGAGGGAGCTTGGACAAAGGACCCTCTAAAGTTTGACAACTCCTACTTTA
AGTAAGGCATCTTTTTTTCTTTAATCTATAAACACATGCTAGTTAAATTAT
ATAACAACTGGAAACTGAGTGTACCTGTATTTGCAATTTGTACTCTTGACCAGGAAGCTTTTAGGAGGAGATTCAGGACTATTAAAACTCCCCACTGATAAGGCTTTAGTGGAAGATCCT
ATTTTCCGCCAGTATGTTGAACGATATGCAGG
GGTAATGTGTTTAATTTATGAATGTGAAAATCAGTTTCTGAATTACCACACATTAACTGGAAAAGATGTTAATTATTGCAGGACGAGG
ATGCATTCTTTGCAGATTATGCAGCCTCCCATAAGAAATTATCAGAGCTGGGATTCACCCCACCTGCCAGAGGAACATTAGCTACAAAGTGCTGTACACTATTTGCACAGGGTGCTGTTG
GGGTTGCTTTAGCTGCTGCCTTGGTGGTTCTGGGTTACTACTATGAAGCTCACAGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATGCAGAGTACTTAAAGGAGATAGAGAAGGCTCGTAGAGACCTTCGCGCACTCATTTCCAGCAAAAGCTGTGCTCCTATCATGCTTCGTCTTGCGTGGCATGATGCAGGGACTTAT
GATGCGAAAACGAAGACAGGAGGACCTAATGGTTCTATTAGGAATGAGATAGAGTACAAGCATGAAGCTAATAATGGTCTTAAAATTGCCATTGATTTATGCG
AGGATATCAAGGCTAGA
CATCCCAAAATTTCATATGCTGACCTCTATCAG
CTTGCTGGGGTTGTTTCTGTTGAGATCACAGGAGGTCCGACCATTGAATTTGTTCCAGGCAGAAAGGATTCAACTCAATCTCCTGAA
GAGGGGCGTCTTCCTGACTCCAGAANNNNNNNNNNNNNNNNNNNNNNNNNN
TACATTGGTAAATTTGTCAGAGATGAAAGTATCATAGAACTTGANTGTGATTCTCACTTGGTTTTGCAG
GGAAAGGCACATAGGGAAAGATCAGGCTTTGAGGGAGCTTGGACAAAGGACCCTCTAAAGTTTGACAACTCCTACTTTA
GGAAGCTTTTAGGAGGAGATTCAGGACTATTAAAACTCCCC
ACTGATAAGGCTTTAGTGGAAGATCCTATTTTCCGCCAGTATGTTGAACGATATGCAGG
GGACGAGGATGCATTCTTTGCAGATTATGCAGCCTCCCATAAGAAATTATCAGAGCTGGGA
TTCACCCCACCTGCCAGAGGAACATTAGCTACAAAGTGCTGTACACTATTTGCACAGGGTGCTGTTGGGGTTGCTTTAGCTGCTGCCTTGGTGGTTCTGGGTTACTACTATGAAGCTCAC
AGAAA

Retrieve as FASTA