Entry information : RcAPx06 (29908.m006074)
Entry ID 9332
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcAPx06 (29908.m006074)
Name (synonym) RcAPx06 (29908.m006074)
Class Ascorbate peroxidase     [Orthogroup: APx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcAPx06
start..stop
S start..stop
MeAPx02 268 4e-90 1..186 1..186
MeAPx02 115 6e-31 187..244 292..349
PtAPx10 268 8e-90 1..186 1..184
PtAPx10 115 7e-31 187..244 290..347
CclAPx01 255 6e-85 1..186 1..186
CclAPx01 110 6e-29 187..244 292..349
VvAPx07 254 9e-85 1..186 1..181
VvAPx07 112 1e-29 187..244 287..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1467015..1467116 102 N° 2 1466765..1466863 99 N° 3 1466423..1466507 85 N° 4 1466303..1466337 35
N° 5 1466124..1466189 66 N° 6 1465952..1465992 41 N° 7 1465510..1465640 131 N° 8 1465293..1465357 65
N° 9 1465064..1465171 108  
complement(join(1465064..1465171,1465293..1465357,1465510..1465640,1465952..1465 992,1466124..1466189,1466303..1466337,1466423..1466507,1466765..1466863,1467015. .1467116))


exon

Literature and cross-references RcAPx06 (29908.m006074)
DNA ref. Phytozome 11:   29908 (1467116..1465064)
Protein sequence: RcAPx06 (29908.m006074)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   244
PWM (Da):   %s   26767.69  
PI (pH):   %s   5.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVTFLSTIPSLVHLSSLSNPTTSTVTHRLPPRAGPICGIKNETDVTSENDFLRRDVLKCFGATIGMELITSSGSFVEMAYAADLIQRRQRSEFQSNIKGTLYTALEKPELVPSILTLALNDAMTYDKASKSGGPNGSIRFSSEISRPENEGLAAALNMLEEAKEEIDSYSKGGPISFADLIQCDVLPWVQKYQRSRETVSQTDYEVDLITTLTKLSSLGQQINYEAYTYPVRKIDVTKLK

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (A long sequence in frame is missing which can not be found).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGTGACTTTCCTCTCAACTATCCCTTCTCTTGTTCATCTCTCATCTCTAAGCAACCCCACCACCAGTACTGTCACTCATAGACTCCCTCCTCGTGCTGTAAGCTTATCTCATCTC
TGCCTTCAGATGCTTCTTTTCACTTACAAAGAAAATGCGAGTTCATATTTAGATGTATGTATATAATATAATACTATTGCAGCTAAGCATAATCAAGAAACCATTTCTGTTGTTTTTGAA
CATGTGTCAACAGGGTCCTATTTGTGGCATTAAGAATGAGACCGATGTTACTAGTGAAAATGATTTCCTTCGAAGAGATGTTTTAAAATGCTTCGGTGCTACCATTGGCATGGTAAGACC
AGATTTTCCCTTTCTTTTCTGTGGCCTGTTTCTGCATTTGTATATATTAATAATCTAGCATTCCATTTTATTAGTTCCTATATTAAAAAGAATGATTCTTCTCCATCAATCTATGTGAAA
ACTTGTGGACTAATTGTTACATTTGTAAAAGGGAGAAAAAATCTAGCTAGGCATTTTCAAGATATATGGAAATTCCTTGATTTTGAATGATGTGATGATGAGTTTCTACCAGTTGTGATA
TCACCTTAGGAACTAATAACAAGCTCTGGATCATTTGTCGAAATGGCTTATGCTGCTGATTTGATTCAACGCAGACAGCGTTCTGAGTTTCAGTGTAAGTCATCTAAACACTTTTCTTTA
AATTTCCTTGCTAGAAACCACCTATAATCTTCTCAACTGAAGCTGATTCATTTTTACAGCAAATATTAAGGGGACCCTTTACACAGCGTTAAAGGTAAATCTTATTTTCCTGCAACAATG
CCTTCTCTTTTTGTCATATACCTGTTTTATGCTTCATACAAGGAAACCACTTGTTACTACTTTGTCGTGCTTCCTTTGTGTTTGCAGGAAAAACCTGAACTTGTCCCATCAATACTAACT
CTGGCACTAAATGATGCCATGACTTATGATAAG
GTCAGACCTGAAACTCTACCTGTTAAAATATTTATCTTCAGGTTATGGAAGTCCTTTACTTTCTGTATAAGAGAAAAAGCGAACAAA
ATCTCTATATATATATATATACACTGATTTCTTTCTGATTGCAGGCTTCCAAATCTGGGGGCCCAAATGGATCCATACGTTTCAGGTATCTACTACATGAAGTATTACTCTCATATGATT
TGGAACAATAATTAGTTGGAAGTATGAATGACGATATCGGATTTGTGCATATTTTTACTGTTACAAAGCCTCACAACTTGCGGTTTTTCTGAAGTAACTTGATAGTATGAAGAGATTTCA
ATTCATGCTTGTTTTCTAGCTTTTCAAAGTTCATTATAATACATGCTTTTCTCCTTTGACTTATCAACTAATTCATTTTATGCAATTTTGAAGAATTATCCTTCTTTCTTTTTCAACAGC
TATCTTAATTTTCTTGTCTTTCTTTCCTGCTTGAAGTTCAGAGATAAGCAGACCTGAAAACGAGGGACTTGCTGCAGCTTTGAATATGTTAGAGGAAGCAAAGGAGGAGATAGATTCATA
TTCGAAGGGTGGACCCATCTCCTTTGCAGATCTTATCCAATGTGCAG
GTTCTACATGTTAAATCCACCAAGTTTCAGACCTGCTGCATGTAATGGCCATTTGCAGGAGCTATTATATGCA
GATATCAAAATATATTTGTCTAATTCATGTTCTTCGTTTTAGCAGCACAAAGCGCGGNNNTTACTGGCCACTGACCCAGATGTTTTGCCATGGGTTCAGAAGTACCAGCGTAGTCGAGAA
ACTGTCTCTCAGACAGATTATGAG
GTTAGTACTTCAAAGTGAGCAAAGATCAAAGTCTGAAATTCGAGATTTATGATTCTTGGGCATATCTATATATTGCTTTGCTTTTCTTATTTTTAT
AGTACCTAAATTGATTCAATTTCAGGTTGACCTGATAACTACTCTCACCAAATTAAGTTCCTTGGGCCAACAAATCAATTATGAAGCATACACATATCCTGTCCGAAAGATAGATGTGAC
CAAACTCAAATTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGTGACTTTCCTCTCAACTATCCCTTCTCTTGTTCATCTCTCATCTCTAAGCAACCCCACCACCAGTACTGTCACTCATAGACTCCCTCCTCGTGCTGGTCCTATTTGTGGCATT
AAGAATGAGACCGATGTTACTAGTGAAAATGATTTCCTTCGAAGAGATGTTTTAAAATGCTTCGGTGCTACCATTGGCATG
GAACTAATAACAAGCTCTGGATCATTTGTCGAAATGGCT
TATGCTGCTGATTTGATTCAACGCAGACAGCGTTCTGAGTTTCAGT
CAAATATTAAGGGGACCCTTTACACAGCGTTAAAGGAAAAACCTGAACTTGTCCCATCAATACTAACTCTGGCA
CTAAATGATGCCATGACTTATGATAAG
GCTTCCAAATCTGGGGGCCCAAATGGATCCATACGTTTCAGTTCAGAGATAAGCAGACCTGAAAACGAGGGACTTGCTGCAGCTTTGAATATG
TTAGAGGAAGCAAAGGAGGAGATAGATTCATATTCGAAGGGTGGACCCATCTCCTTTGCAGATCTTATCCAATGTGCAG
ATGTTTTGCCATGGGTTCAGAAGTACCAGCGTAGTCGAGAA
ACTGTCTCTCAGACAGATTATGAG
GTTGACCTGATAACTACTCTCACCAAATTAAGTTCCTTGGGCCAACAAATCAATTATGAAGCATACACATATCCTGTCCGAAAGATAGATGTGACC
AAACTCAAATTA

Retrieve as FASTA