Entry information : RcPrx06 (28138.m000074)
Entry ID 9337
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx06 (28138.m000074)
Name (synonym) RcPrx06 (28138.m000074)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx06
start..stop
S start..stop
MePrx133 572 0 23..329 18..324
MePrx03 552 0 26..327 25..326
EgrPrx68 535 0 1..329 1..325
EglPrx68 535 0 1..329 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 74198..74416 219 N° 2 74794..74991 198 N° 3 76858..77023 166 N° 4 77696..78099 404
join(74198..74416,74794..74991,76858..77023,77696..78099)


exon

Literature and cross-references RcPrx06 (28138.m000074)
DNA ref. Phytozome 12:   28138 (74198..78099)
Protein sequence: RcPrx06 (28138.m000074)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (303)
PWM (Da):   %s   36247.62 (33336.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.74 (9.63) Peptide Signal:   %s   cut: 27 range:27-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESRRSYAFIVLSMLLLLLPPPLLSAQLTQNFYSKTCPSVESIVRSAVQKKFQQTFVTAPATLRLFFHDCFVRGCDASVLLASPTNNAEKDHPDNLSLAGDGFDTVIKAKAAVDSVPQCRNKVSCADILALATRDVINLAGGPFYAVELGRRDGRISTKASVQHRLPGPNFNLDQLNSIFASHGLTQTDMIALSGAHTLGFSHCSRFSKRIYNFSPKNRIDPTLNMQYAFELRKMCPVKVDPRIAIDMDPTTPQKFDNAYYRNLQQGKGLFTSDQVLFTDPRSKPTVNQFASNNLAFQNAFVAAIKKLGRVGVLTGNQGEIRNDCTRI

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAAGCCGAAGGTCCTACGCCTTCATCGTTCTATCAATGCTTCTTCTTCTTCTCCCCCCACCTCTCCTTTCTGCTCAACTTACCCAAAACTTCTACAGTAAAACATGTCCTAGTGTT
GAATCAATAGTTCGTTCTGCTGTCCAAAAGAAGTTCCAACAAACCTTTGTTACTGCTCCGGCAACTCTTCGACTGTTTTTCCATGATTGCTTTGTCCGG
GTAATTAGTACTTTCTCTGTT
GTTTCGAATAAATTTTTTTTCTTCGATTTTCTTTTACCATTTTTTCAGTTTTATCATTATTACTTGTGTGAGAGAGCATTAGCAAAGTACGTGAGATGAAATTTATAGTAATTTTGATTA
TTTTAATATACGAGTAATTTAGTCATTTTTAATTTTTTTTGTTATGATTAAGACTTTTTAACAGAATTTTTAATTTTTCTGCGATTTTTTAAAAGCACTATTAAAATAAAACGAATGGAA
ATATATTATTATCATTATTTTGTATATCTAGAGAGTCCCATTCACTGAGGATGCTTGTTAGATTGAAAGTTTTTTTCATGCTAATGGCAAATATGAACTTAATTTGCTGTGATTAGGGAT
GTGATGCATCAGTGCTGCTAGCATCACCTACCAATAATGCGGAGAAGGATCATCCTGATAATCTTTCGTTGGCTGGGGATGGATTTGACACAGTGATCAAGGCCAAGGCTGCTGTTGACA
GTGTTCCTCAATGCAGGAACAAAGTTTCATGTGCTGATATTCTAGCTCTTGCTACTAGAGATGTCATCAACTTG
GTATTGAAATGCAACCTTCATTTCCTTTCTACTTTAATCTTTTTTT
TTTCTTTTGCCATTTGTTTGCATGAGTTATATTATAAAATTAATTATTATGACACTTGGAGACTTGTCTCAATAGACACTTTAATCTCAACTAAATTAATATTTAGACTTTTAAGTTTTG
ACTATTTAATTATTTTAACATCTTAATTTTTAATATGATTTTACAGACATTTTAATTTATTATTTTATGATATTTACATATTGTTTTGATATATGGTTTCATTTGATGTGTTAATGCTTA
TTGCATATAGATGTTTAAATATAATTAAAAAATAAAATTCAACTATCTATTAAATTAAATAAGAAACTAAAGATGTCTAAGTGATTATAAAATATAATTTTAAGTGTTTTATTAAATTAA
ATTAAAATTAAAGTATTAAAATAACTAAATGATTAAAATATAAATATTTAATTAATCTCTTTCTTCAAACCGTCCAAAATCGACAATTCCCTGTAGTTGAAGACAAACTAGGGACTATAT
TGTCACTAAAAGTAACTTAACAATAACCTTTTAGCTTCCTCTAAATAGATTTGTAATAGTTGATTGACGTAAATGTGTACTGTAATGCATAATAATTTTTATTTTACAAATGATATATAC
ATTTTAAGTGGTGATGAGAATATTTCATATTTTTAGTCTTTTTATTAATAAAAATATAATAATTTACTGATGAAAAATTGTGTCCTTAACATAATTTTAATAATTTCTCAAAAATACATA
ATCTTAATAATGGGAAAAAAAATCTATATGACGGTGGATAATATAATTGATCAAAAATCATGTTTAATAAGGAAAAATTGTTCATATAATAAGCAAAATTTTCTTGCCAACATGAATTTT
AACGAGAGGGCAATTGTTAATTTAATTGGGGGTTTTTAATGTTAAAGTAATATTTAAGGCGAGTTAAATGATATCATTACAATTAAATTTTTCTTTTATTATGAATATCATCTATATTAA
AATTAATATTCAAAATCATTTTTTAGCATGACTATCATTTTAAAAAAAAAAATAATAAAAGCAAGCTGTGGCGGTAATTTCTTTATCTTTAAAAATATATAATAGTGAGATTTTTATATT
TAATATTATTTATGGTGCTAAATTAATATAAACTTACTGAGTCAGCATCAATTTCGATTTTACCTTAATATCCAACATGCCTCATGAAATGCTTAAGTCCTATTAAATATCCTCTATATA
GTTTTGGTTTATTAATATCATCAAATTTATGAATTAACAAAATATTTATAATATGTTGGTGTTAATGACGTTAAGAATTGAATTTTCATAATCTCATTAAATATCAAATAAATAAATAGG
ATTGATAAAATCAAGTGATCGGCTTCATGACCTTATTGTAATTATTTGACTATTTTGATTGGTTTGTACACTTTACTCTTATAATGTTCTAGCATTTGCTTTAGGATATGGCTTTTAAAG
TAATATTCTATTATTAATAAATATTGACACCTTAATTAGATTCTATTATTTTTTATTAAAGTTACGTACCAGTCTTATTTAAATAGATTTTTTAAATCAAAATAAATAAAATAAGAAAGC
TATTCTCATATAAAAGCAATAAAAATAAAAATAAAAAAGACAAAATAAGAAAGCTATTCTCATCTAAAAACAATAAAAATAAAAATAAAAATGAGACAGCAGTAAGTAAAAGAAAATAGA
TATATCTCTTCACCAATATAAAATTGTATCATGTTTAACTGCCCCCATGTGCATGATTAAGCATCTACTGAGTTCCATAAATTTAAACAATTGCTTGTGGGGTGTAGTCATGTTAAATAA
ATATATATGTGCAAATGCAGGCAGGAGGACCATTTTACGCAGTTGAATTGGGAAGGCGAGATGGGAGGATATCAACAAAAGCTAGTGTTCAACATAGACTCCCTGGTCCTAACTTTAACT
TAGATCAGCTAAATTCCATCTTTGCCTCACATGGTCTCACCCAGACTGACATGATTGCACTATCAG
GTACTTCAGTTTTCTTAATTAGTGTTTCTATTATGTATTTCACTATTCAAATTC
AACATGTACATTTGGCAATTTTTAACAAAAGCTTCTTGATGCTGTCTTTATTCTTGTTGCCCACTTAAAAGCCAAATGATTTGTACATTTTTTATGTTAGAAAATTAGTACTTGATTCCA
CAATTTGGATTAGAATTGCTTATTTAAATTAACAGTTATCGGCAAATTTAATTGTATTTTATTATTAATTGTAATTAAATCCCTCCAGCATGAACCTTGTGTATTTTAAACATGTAAATA
TATAATGTTATAGTATGATAAAAGATAATAGGGTTATCTCTCACTTTTTCTCTCATTTTTATTAGTGTTTAGTAAGTATCAAGTAACATATTTAATGGTCAAAATTAAAAGTTTATATCC
ATTAGCTATAATCTAATATGTCTAAATTACACCAGCTGCATATTAGGAAAAGCCTGATCTTTTAAGCTCCTTAACACTGTTAACTCATTAAGTACTCTAATATGGTTCTCTATATGTTTG
TAAATTACAAAGTCTCGAATTTGAAGTTCAATCGTAACCCCATTTGCCCAGAAGAAGAAAAAAATTATTTACCAGCTGATCAAGAAAACAGGATCAAACAGGTTGGTTCATTCTAACAAC
ATAGTTATTCCATTATAGGTGCACACACACTTGGGTTCTCTCATTGCAGCCGCTTCTCCAAACGTATCTACAACTTCAGCCCTAAAAACAGGATCGACCCAACACTGAATATGCAATATG
CATTTGAGCTGAGAAAGATGTGCCCTGTCAAAGTTGATCCAAGGATTGCCATTGACATGGACCCAACCACACCTCAGAAATTTGACAATGCATACTACAGAAATCTCCAACAAGGAAAAG
GGTTATTCACCTCCGACCAGGTGCTGTTTACTGATCCAAGATCAAAGCCCACTGTCAACCAATTTGCTTCAAACAATTTAGCCTTTCAAAATGCTTTTGTTGCTGCCATTAAAAAGCTTG
GCAGAGTTGGGGTCTTGACTGGAAATCAAGGCGAAATAAGGAATGATTGCACCCGTATCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAAGCCGAAGGTCCTACGCCTTCATCGTTCTATCAATGCTTCTTCTTCTTCTCCCCCCACCTCTCCTTTCTGCTCAACTTACCCAAAACTTCTACAGTAAAACATGTCCTAGTGTT
GAATCAATAGTTCGTTCTGCTGTCCAAAAGAAGTTCCAACAAACCTTTGTTACTGCTCCGGCAACTCTTCGACTGTTTTTCCATGATTGCTTTGTCCGG
GGATGTGATGCATCAGTGCTG
CTAGCATCACCTACCAATAATGCGGAGAAGGATCATCCTGATAATCTTTCGTTGGCTGGGGATGGATTTGACACAGTGATCAAGGCCAAGGCTGCTGTTGACAGTGTTCCTCAATGCAGG
AACAAAGTTTCATGTGCTGATATTCTAGCTCTTGCTACTAGAGATGTCATCAACTTG
GCAGGAGGACCATTTTACGCAGTTGAATTGGGAAGGCGAGATGGGAGGATATCAACAAAAGCT
AGTGTTCAACATAGACTCCCTGGTCCTAACTTTAACTTAGATCAGCTAAATTCCATCTTTGCCTCACATGGTCTCACCCAGACTGACATGATTGCACTATCAG
GTGCACACACACTTGGG
TTCTCTCATTGCAGCCGCTTCTCCAAACGTATCTACAACTTCAGCCCTAAAAACAGGATCGACCCAACACTGAATATGCAATATGCATTTGAGCTGAGAAAGATGTGCCCTGTCAAAGTT
GATCCAAGGATTGCCATTGACATGGACCCAACCACACCTCAGAAATTTGACAATGCATACTACAGAAATCTCCAACAAGGAAAAGGGTTATTCACCTCCGACCAGGTGCTGTTTACTGAT
CCAAGATCAAAGCCCACTGTCAACCAATTTGCTTCAAACAATTTAGCCTTTCAAAATGCTTTTGTTGCTGCCATTAAAAAGCTTGGCAGAGTTGGGGTCTTGACTGGAAATCAAGGCGAA
ATAAGGAATGATTGCACCCGTATCAAC

Retrieve as FASTA