Entry information : RcPrx09 (28320.m001136)
Entry ID 9340
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx09 (28320.m001136)
Name (synonym) RcPrx09 (28320.m001136)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx09
start..stop
S start..stop
PtPrx78 572 0 1..321 1..321
CclPrx45 558 0 1..321 1..322
PpePrx26 555 0 9..321 9..321
CsPrx29 553 0 9..321 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 359835..360035 201 N° 2 359493..359672 180 N° 3 359212..359374 163 N° 4 358589..359007 419
complement(join(358589..359007,359212..359374,359493..359672,359835..360035))


exon

Literature and cross-references RcPrx09 (28320.m001136)
DNA ref. Phytozome 12:   28320 (360035..358589)
Protein sequence: RcPrx09 (28320.m001136)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (301)
PWM (Da):   %s   34810.48 (32591.3)  
PI (pH):   %s   6.51 (6.88) Peptide Signal:   %s   cut: 21 range:21-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METFWLVSLVILAMALSVQSQLRNGFYSSSCPQAESIVRSTVQSHFQKDPTIAAGLLRLHFHDCFVQGCDGSVLITGSSAERNALPNLGLRGFEVIDDAKSQLEASCPGVVSCADILALAARDAVDLSDGPSWSVPTGRRDGRISSSSQASNLPSPFDSIAAQKQKFAAKGLDDEDIVTLVGAHTIGQTDCLFFRYRLYNFTTTGNADPTINQSFLAQLRALCPKDGDGSKRVALDKDSQSKFDASFFKNVRDGNGVLESDQRLWDDAATRDVVQKYAGNIRGLLGFRFNFDFSKAMIKMSIIEVKTGTDGEIRKVCSKF

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTTTCTGGTTGGTTTCTCTTGTGATTTTGGCGATGGCTTTGTCTGTGCAAAGCCAATTGAGAAATGGGTTTTATTCTTCTTCGTGCCCACAGGCTGAATCCATAGTTAGGTCA
ACTGTTCAGTCCCACTTCCAAAAGGATCCAACCATTGCTGCTGGATTGTTAAGGCTTCATTTCCATGACTGCTTTGTTCAG
GTTTCCTTTTTTTTCTTCTGCTTTCTTTCAGCTTCACAA
TTTTTGACAAATATCAGCTGGAATCTTTTTTTTTTTAAGATATTCATTATTTACATAATATAACATGTCAACTTTGTATAATCTGACAAGCTTTTAATCATTATTTATAGTATTGTTTCA
CAGGGTTGTGATGGATCGGTGTTGATCACAGGGTCTTCTGCGGAGAGAAATGCATTGCCAAATCTAGGATTAAGAGGATTTGAAGTAATTGATGATGCCAAATCACAATTAGAGGCATCA
TGCCCTGGGGTAGTTTCATGTGCCGATATTCTAGCATTAGCTGCTCGTGATGCTGTAGACTTG
GTAACTAATTAAATAATTAATCTCCTTTGATCAATAATAATTGTACAAATTAAAATA
AAAACATGATTTTCTCATATTGGAGATGCTTTGTTATAATTAATTACCACATTTATTTCAGAGTGATGGTCCAAGTTGGTCGGTCCCAACCGGCAGAAGAGACGGCAGAATCTCTTCATC
ATCTCAAGCCTCCAATTTACCTTCTCCTTTCGACTCTATCGCCGCTCAGAAGCAAAAATTTGCAGCGAAAGGTCTTGACGACGAGGATATCGTAACCTTAGTTG
GTACCTATATATCATG
TTTCTCTTCTTCCATTTTATGTTACCTTACATATACAATTACGTATGTTAATCAAACCTTAATGCATTAGTAAAGTCGATGCACCATAATTTAAATTTATGAACCCACTATATATGAAAA
GTTTATGCACTGATTTCTTTTAAGTTTTTTTGTTTAAGTTATATTTAATTAAATGATTTACGTTGCAGGGGCACATACCATAGGTCAAACAGACTGCTTATTCTTCAGATACCGACTGTA
CAATTTCACAACAACAGGCAACGCAGACCCAACAATAAATCAATCATTCCTGGCTCAACTTCGAGCCCTCTGTCCAAAAGATGGTGATGGGTCGAAAAGGGTTGCATTAGACAAAGACAG
CCAAAGTAAATTTGATGCAAGCTTTTTTAAGAATGTAAGAGATGGAAATGGAGTTTTAGAATCTGACCAGAGACTTTGGGATGATGCTGCTACTCGTGATGTTGTCCAAAAGTATGCTGG
AAATATTAGAGGATTGCTCGGGTTTAGGTTTAATTTTGATTTTTCAAAAGCTATGATTAAAATGAGTATCATTGAAGTCAAGACTGGGACTGATGGAGAGATTAGAAAGGTTTGCTCCAA
GTTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTTTCTGGTTGGTTTCTCTTGTGATTTTGGCGATGGCTTTGTCTGTGCAAAGCCAATTGAGAAATGGGTTTTATTCTTCTTCGTGCCCACAGGCTGAATCCATAGTTAGGTCA
ACTGTTCAGTCCCACTTCCAAAAGGATCCAACCATTGCTGCTGGATTGTTAAGGCTTCATTTCCATGACTGCTTTGTTCAG
GGTTGTGATGGATCGGTGTTGATCACAGGGTCTTCTGCG
GAGAGAAATGCATTGCCAAATCTAGGATTAAGAGGATTTGAAGTAATTGATGATGCCAAATCACAATTAGAGGCATCATGCCCTGGGGTAGTTTCATGTGCCGATATTCTAGCATTAGCT
GCTCGTGATGCTGTAGACTTG
AGTGATGGTCCAAGTTGGTCGGTCCCAACCGGCAGAAGAGACGGCAGAATCTCTTCATCATCTCAAGCCTCCAATTTACCTTCTCCTTTCGACTCTATC
GCCGCTCAGAAGCAAAAATTTGCAGCGAAAGGTCTTGACGACGAGGATATCGTAACCTTAGTTG
GGGCACATACCATAGGTCAAACAGACTGCTTATTCTTCAGATACCGACTGTACAAT
TTCACAACAACAGGCAACGCAGACCCAACAATAAATCAATCATTCCTGGCTCAACTTCGAGCCCTCTGTCCAAAAGATGGTGATGGGTCGAAAAGGGTTGCATTAGACAAAGACAGCCAA
AGTAAATTTGATGCAAGCTTTTTTAAGAATGTAAGAGATGGAAATGGAGTTTTAGAATCTGACCAGAGACTTTGGGATGATGCTGCTACTCGTGATGTTGTCCAAAAGTATGCTGGAAAT
ATTAGAGGATTGCTCGGGTTTAGGTTTAATTTTGATTTTTCAAAAGCTATGATTAAAATGAGTATCATTGAAGTCAAGACTGGGACTGATGGAGAGATTAGAAAGGTTTGCTCCAAGTTC
AAT

Retrieve as FASTA