Entry information : RcPrx14 (29272.m000043)
Entry ID 9345
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-05 (Qiang Li)
Peroxidase information: RcPrx14 (29272.m000043)
Name (synonym) RcPrx14 (29272.m000043)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx14
start..stop
S start..stop
JcPrx01 565 0 8..339 4..334
MePrx124 563 0 1..339 1..340
PtPrx37 540 0 1..337 1..336
PpePrx77 506 0 7..339 12..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14426..14677 252 N° 2 15538..15717 180 N° 3 15964..16123 160 N° 4 16290..16714 425
join(14426..14677,15538..15717,15964..16123,16290..16714)


exon

Literature and cross-references RcPrx14 (29272.m000043)
DNA ref. Phytozome 12:   29272 (14426..16714)
Protein sequence: RcPrx14 (29272.m000043)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (312)
PWM (Da):   %s   37755.02 (34936.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.73 (8.83) Peptide Signal:   %s   cut: 28 range:28-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRSGSLVIYPLLVLALSMCMIANVDAASSVQTPVKLRWQYYKKYTKCPEAEVYIRHQVELFWKNDKTITSKLLRLLYSDCFVTGCDASILLDGPDSEKTAKQNWGLGGFAVIDKIKTVMEKRCPGIVSCADILNLATRDAVHLAGAPSYPVLTGRRDGMTSKAASVDLPSPSISLNDALEYFSSKGLDMLDFVTLLGAHSMGKTRCRYVEDRLYNFNNTGKPDPYMDQAFAAQMRKLCPPRTKKGQSDPQVFLNPDSGSNYKFTESFYKRVLSYKSVLGVDQQLLYNNDTLQIAQEFAANFEDLRRSFALSMNRMGNINVLTGNAGEIRQNCHFTNK

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing). Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGATCAGGAAGTTTGGTGATTTACCCACTACTGGTTCTTGCATTAAGCATGTGTATGATAGCTAATGTGGACGCGGCATCTTCGGTACAAACGCCGGTGAAGCTGCGGTGGCAA
TACTACAAGAAGTACACCAAATGCCCGGAAGCCGAAGTTTACATAAGGCACCAAGTAGAGTTGTTCTGGAAGAATGACAAAACCATTACTTCTAAGCTCCTCCGGTTGCTCTACTCCGAC
TGTTTTGTTACT
GTATGTATGCTTGTCCACTTCTCATCCTCAGTTCATTTTTCATTTTTCTTTTACTCTGTGCATGGCAATAAAGAAGATAGGGAAGGGAAGGTATTTTAAAAGAAAAGA
AAGAAAATTGAAGGAAAGGGTAGTGTGTTTGGTCACATTAAAAATTTTCATTAAAGAAAAAAGAAAGAAACTATTTAATTTTAAATTCTTTATTATAATTATAGAGATAAAAATGATTAA
TTATATTTTAATTTTTTTTGCATGAGTTAAAATATTTTACATCCAAAATTGAAATGTAATCTACAAAATAATCGAAGGTATTCCCCTTTAATTCTCTTCCCCTTTTAAAAAGATTTATTT
GCCAAATACGATTAAAATTAATTCTTTATCTCTATTCACTTTCTTTCTCTTTGCAGTACCCTTAATTCATGCATAGTATTAATGACATTCTCCCGCAAATGATTAAAATCTATTATTTTT
CAAATGAAAAATGATCTTAAATCCATAGATTTTAAAAAAGAAATTCCTCCAAATTTAGAGCTAGACGAAAAATCCAAAATCCACTAATATTATGATACTTTTTTTTTTAATATTATTCTA
ATAAATTTATATTATCTTAAAATTATTCTTTAACTTTTGTTTTCAGATCCTTAACTTATATATATATATATATACAAAGAATAATTATCAATACATTGTATCTATATTAATCCAACTTAT
ACCATTTTAAAAATATATAGATTTTAAATAAATTCATGGATTCTAGAATTTGTCGGTAGAAGGCCAGCACTAGTAGGGTTGAAAAGGACTGAAGCTTAATCGTCCATTTTTCTTCTTCTC
TGCTTAAAACCGTTGGTTCGATACGATTTCAGGGTTGTGATGCATCAATTCTTCTGGACGGACCAGATTCAGAAAAGACTGCAAAGCAAAATTGGGGACTCGGTGGGTTCGCAGTCATTG
ACAAGATTAAAACAGTTATGGAAAAACGCTGCCCTGGAATTGTCTCCTGCGCTGACATTCTTAATCTTGCCACCAGGGATGCTGTTCATTTG
GTGAGATCCTTCACGTCCTACTTCAAAT
CTTTATATTCCCTCTAATCTCACTTGGTCATAATCTATGGAAGTTGTCTGCTTTTCGGTGCAGCTACTCGAGATGTACATGTCATTTTATTAGTTTTAACAAAAATGAAAATGCAATGAC
AATGAAATATTTTGAGGCAATTCATCACATGGGAACAGCATAATTTTTTTTACTTTAGAATTTCATGATGTATGATTAATGATCCAATGAACCAACAGGCAGGTGCACCATCTTATCCTG
TATTGACAGGAAGAAGGGACGGAATGACATCAAAAGCTGCATCAGTAGACCTCCCATCACCATCCATCTCGTTGAATGATGCATTGGAATACTTCAGTTCTAAAGGCTTAGATATGCTGG
ATTTTGTAACCCTCCTAG
GTATGAATATCTCAAGTCACCAGAAACAAGAAAAGAAAACAATATTTAATGTCCTTAGTTTGGTTACATTGCCCTGTCTTAGTTTGGTTATATTAGCCTGTT
TCTATAAACAGGACCCCTTTTGTTTCCTGTCAAATAATCATATGTGTATTTGTGTGTGTATCAGGGGCACATTCAATGGGTAAAACCCGCTGTCGCTATGTCGAGGACCGTCTCTACAAT
TTCAACAATACAGGAAAGCCAGACCCATACATGGACCAAGCATTTGCAGCTCAGATGAGAAAGCTATGTCCACCCAGAACCAAAAAGGGCCAAAGTGATCCTCAGGTGTTTCTAAACCCT
GATTCCGGTTCTAACTACAAATTCACAGAATCCTTCTACAAGAGGGTTTTGTCATACAAAAGTGTCCTTGGAGTTGATCAGCAACTGCTATACAATAATGACACACTACAGATTGCACAA
GAATTTGCTGCTAATTTTGAGGATTTGCGAAGGTCATTTGCACTATCAATGAACCGAATGGGAAACATCAATGTTCTAACGGGAAATGCAGGAGAGATACGCCAGAATTGCCATTTCACA
AATAAGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGATCAGGAAGTTTGGTGATTTACCCACTACTGGTTCTTGCATTAAGCATGTGTATGATAGCTAATGTGGACGCGGCATCTTCGGTACAAACGCCGGTGAAGCTGCGGTGGCAA
TACTACAAGAAGTACACCAAATGCCCGGAAGCCGAAGTTTACATAAGGCACCAAGTAGAGTTGTTCTGGAAGAATGACAAAACCATTACTTCTAAGCTCCTCCGGTTGCTCTACTCCGAC
TGTTTTGTTACT
GGTTGTGATGCATCAATTCTTCTGGACGGACCAGATTCAGAAAAGACTGCAAAGCAAAATTGGGGACTCGGTGGGTTCGCAGTCATTGACAAGATTAAAACAGTTATG
GAAAAACGCTGCCCTGGAATTGTCTCCTGCGCTGACATTCTTAATCTTGCCACCAGGGATGCTGTTCATTTG
GCAGGTGCACCATCTTATCCTGTATTGACAGGAAGAAGGGACGGAATG
ACATCAAAAGCTGCATCAGTAGACCTCCCATCACCATCCATCTCGTTGAATGATGCATTGGAATACTTCAGTTCTAAAGGCTTAGATATGCTGGATTTTGTAACCCTCCTAG
GGGCACAT
TCAATGGGTAAAACCCGCTGTCGCTATGTCGAGGACCGTCTCTACAATTTCAACAATACAGGAAAGCCAGACCCATACATGGACCAAGCATTTGCAGCTCAGATGAGAAAGCTATGTCCA
CCCAGAACCAAAAAGGGCCAAAGTGATCCTCAGGTGTTTCTAAACCCTGATTCCGGTTCTAACTACAAATTCACAGAATCCTTCTACAAGAGGGTTTTGTCATACAAAAGTGTCCTTGGA
GTTGATCAGCAACTGCTATACAATAATGACACACTACAGATTGCACAAGAATTTGCTGCTAATTTTGAGGATTTGCGAAGGTCATTTGCACTATCAATGAACCGAATGGGAAACATCAAT
GTTCTAACGGGAAATGCAGGAGAGATACGCCAGAATTGCCATTTCACAAATAAGAAA

Retrieve as FASTA