Entry information : RcPrx17 (29634.m002067)
Entry ID 9347
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx17 (29634.m002067)
Name (synonym) RcPrx17 (29634.m002067)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx17
start..stop
S start..stop
MePrx01 615 0 1..331 1..331
CclPrx35 605 0 1..330 1..330
PbPrx02 603 0 1..331 1..333
CsPrx10 603 0 1..330 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106394..106618 225 N° 2 106063..106254 192 N° 3 105811..105976 166 N° 4 105269..105678 410
complement(join(105269..105678,105811..105976,106063..106254,106394..106618))


exon

Literature and cross-references RcPrx17 (29634.m002067)
DNA ref. Phytozome 12:   29634 (106618..105269)
Protein sequence: RcPrx17 (29634.m002067)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   36045.04 (33736.9)  
PI (pH):   %s   8.47 (8.71) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQCMSLFLVLTLLGSAPLCLCWKSNGGYLYPQFYDHSCPNAQQIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASILLDSSGSIISEKGSNPNRNSARGFEVIDEIKAAIEKECPETVSCADILALAARDSTVLAGGPSWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKYKLQGLNVVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDYTLDQSYAAQLRTNCPRSGGDQNLFFLDFASPTKFDNSYFKNLLASKGLLNSDQVLLTKNEASMELVKNYAENNELFFEQFAKSMIKMGNISPFTGSRGEVRKNCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAATGTATGAGCTTGTTCTTAGTTCTTACTCTCCTTGGCTCTGCTCCCCTTTGCTTATGTTGGAAGAGCAATGGTGGGTACCTTTACCCTCAGTTTTATGACCATTCCTGCCCT
AACGCTCAACAGATAGTTAAGTCTGTTGTAGCTAAGGCAGTAGCAAAAGAAGCTCGTATGGCTGCCTCATTACTTAGGCTTCATTTTCATGACTGCTTTGTCAAG
GTCTGTCAGCTTTTT
AGATATTAGATACCTGTTTCTTGCTAAAATGTTCATATTCACTTAGCTTTTTGCCACTATGATTAATCTGCTAGGCTGAAATAACAATATAATGACATAGAAGCTCAAACTTTTGTTGTT
ACAGGGTTGTGATGCATCAATACTGTTAGACAGCAGTGGAAGCATAATCAGTGAGAAGGGTTCTAATCCAAACCGAAACTCAGCTCGAGGATTTGAAGTAATCGATGAGATCAAAGCTGC
AATAGAGAAGGAATGTCCTGAAACTGTATCTTGTGCTGATATTTTAGCCTTAGCTGCTAGAGACTCCACAGTTCTT
GTAAGTTCTTTTTACTTTGCCTTGTGGTGAAAATATACTAACCA
AAACATCCTGACCTGACCATTGCTTTTTCTTCATGTACACAGGCTGGAGGACCAAGCTGGGAAGTTCCATTGGGAAGAAGGGATTCTAGAGGCGCTAGCTTGAGTGGTTCTAACAACAAC
ATTCCTGCTCCAAACAACACATTTCAAACAATTCTCACTAAGTACAAGCTTCAGGGCCTCAATGTTGTCGATCTTGTAGCACTATCTG
GTACTGATTTTGGCTTATCAGAAAAGAATTGG
TTAACTATCAGGAATACAAAATATTCAACTGTGTATTGTTCACTAAATGCTTTCTTCAACAAAAGAAAAACATGACTAAATTCCCATGAATTTCTTGCAGGAAGCCACACAATCGGAAAT
GCTAGATGCACCAGCTTCAGGCAGAGGCTGTACAATCAGTCTGGTAATGGGCAACCTGATTATACACTTGATCAATCATATGCTGCTCAATTGCGCACCAACTGCCCAAGATCTGGAGGC
GATCAAAACCTGTTTTTCTTGGACTTTGCAAGTCCAACAAAGTTTGATAACAGCTACTTCAAGAACCTACTTGCTTCAAAGGGCCTGTTGAATTCTGACCAAGTTCTCCTGACAAAGAAT
GAAGCATCCATGGAACTGGTCAAGAATTATGCTGAGAACAATGAGCTCTTCTTCGAGCAGTTTGCTAAGTCAATGATCAAGATGGGAAATATCTCTCCATTCACAGGTTCAAGGGGAGAG
GTGAGAAAAAATTGCAGGAAAATTAATGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAATGTATGAGCTTGTTCTTAGTTCTTACTCTCCTTGGCTCTGCTCCCCTTTGCTTATGTTGGAAGAGCAATGGTGGGTACCTTTACCCTCAGTTTTATGACCATTCCTGCCCT
AACGCTCAACAGATAGTTAAGTCTGTTGTAGCTAAGGCAGTAGCAAAAGAAGCTCGTATGGCTGCCTCATTACTTAGGCTTCATTTTCATGACTGCTTTGTCAAG
GGTTGTGATGCATCA
ATACTGTTAGACAGCAGTGGAAGCATAATCAGTGAGAAGGGTTCTAATCCAAACCGAAACTCAGCTCGAGGATTTGAAGTAATCGATGAGATCAAAGCTGCAATAGAGAAGGAATGTCCT
GAAACTGTATCTTGTGCTGATATTTTAGCCTTAGCTGCTAGAGACTCCACAGTTCTT
GCTGGAGGACCAAGCTGGGAAGTTCCATTGGGAAGAAGGGATTCTAGAGGCGCTAGCTTGAGT
GGTTCTAACAACAACATTCCTGCTCCAAACAACACATTTCAAACAATTCTCACTAAGTACAAGCTTCAGGGCCTCAATGTTGTCGATCTTGTAGCACTATCTG
GAAGCCACACAATCGGA
AATGCTAGATGCACCAGCTTCAGGCAGAGGCTGTACAATCAGTCTGGTAATGGGCAACCTGATTATACACTTGATCAATCATATGCTGCTCAATTGCGCACCAACTGCCCAAGATCTGGA
GGCGATCAAAACCTGTTTTTCTTGGACTTTGCAAGTCCAACAAAGTTTGATAACAGCTACTTCAAGAACCTACTTGCTTCAAAGGGCCTGTTGAATTCTGACCAAGTTCTCCTGACAAAG
AATGAAGCATCCATGGAACTGGTCAAGAATTATGCTGAGAACAATGAGCTCTTCTTCGAGCAGTTTGCTAAGTCAATGATCAAGATGGGAAATATCTCTCCATTCACAGGTTCAAGGGGA
GAGGTGAGAAAAAATTGCAGGAAAATTAATGCT

Retrieve as FASTA