Entry information : RcPrx21 (29661.m000899)
Entry ID 9349
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx21 (29661.m000899)
Name (synonym) RcPrx21 (29661.m000899)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx21
start..stop
S start..stop
MePrx60 574 0 3..334 1..329
LuPrx69 565 0 12..333 19..340
MePrx11 562 0 7..334 3..329
EguPrx134 559 0 8..334 4..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6026..6256 231 N° 2 6362..6562 201 N° 3 6692..6857 166 N° 4 7470..7873 404
join(6026..6256,6362..6562,6692..6857,7470..7873)


exon

Literature and cross-references RcPrx21 (29661.m000899)
DNA ref. Phytozome 12:   29661 (6026..7873)
Protein sequence: RcPrx21 (29661.m000899)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (305)
PWM (Da):   %s   36140.18 (32886.5)  
PI (pH):   %s   9.12 (9.09) Peptide Signal:   %s   cut: 30 range:30-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMGCLRFDVILVFSLSLSFFLFSNTVSAQQLRQNYYANICPNVESIVRSTVQKKFQQTFVTVPATLRLFFHDCFVQGCDASVVVASTPNNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPSCRNKVSCADILAMATRDVVALSGGPSYAVELGRLDGLSSTAASVNGKLPQPTFNLNQLNSLFAANGLSQTDMIALSAAHTLGFSHCGKFANRIYNFSRQNPVDPTLNKAYATQLQQMCPKNVDPRIAINMDPKTPQTFDNAYYKNLQQGMGLFTSDQILFTDARSRPTVNAWASNSPAFQQAFVAAMTKLGRVGVKTGRNGNIRTDCGVL

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATGGGTTGTCTTCGATTTGATGTGATTCTTGTATTTTCACTTTCCCTCAGTTTCTTTCTCTTCTCTAATACAGTATCAGCTCAGCAATTGAGACAGAACTATTATGCCAATATT
TGCCCAAATGTAGAAAGTATAGTTAGAAGTACAGTTCAGAAGAAATTCCAACAGACTTTCGTCACTGTTCCTGCAACCCTCCGTCTCTTCTTCCACGATTGCTTTGTCCAG
GTAATTAAT
CTTCTCTCTTTTGATAAATTAGCATATACCCGTTACACCATTTTAGCTAAATATATAAGTTCACGAATTTTGGTTAATGTGCTTATATATATATAGGGATGTGATGCCTCAGTCGTAGTT
GCTTCCACTCCAAACAACAAAGCAGAGAAAGACCATCCTGATAATTTATCACTGGCCGGAGATGGATTTGACACCGTAATCAAGGCTAAAGCCGCCGTGGACGCAGTCCCCAGCTGCAGA
AATAAAGTTTCATGTGCAGATATATTAGCCATGGCAACAAGAGATGTGGTTGCCCTG
GTAAGCAGTCTTCTCTCATAAGATTCTTTAGGCTTTTAGTCTATATGCTAATCAATAGAGATG
ATGTAATTAATCAAGAGTTGTTAATCTTAAGGGTGTGGATTTAATATGAAATATGAATGATGGCAGTCTGGTGGGCCTTCATATGCTGTTGAATTGGGAAGATTGGATGGTCTAAGCTCA
ACCGCTGCTAGTGTTAATGGCAAACTGCCTCAGCCAACTTTTAATTTGAATCAGCTTAATTCTTTGTTTGCTGCTAATGGGCTATCCCAAACTGACATGATTGCTCTTTCAG
GTACGTTG
TATAAAATTATTCTTATTTGTATTATGCAGTTTTAACGTACCAAAAAAGTCAACATTGCATAATCATGTAGATTAATTAATTAATTGACAGCTCGTGGGATGATTTTATTTGACAAAGTT
CAAATTTAAAATAATTGGACCATGATGACCAATCTTATATGAAATTAGATGATTGTGCGACACACATTACAATTATAAGATGAGAAGTCTATTGTCTACGATATGTCTTCCTTATGTGGA
TTCTCATGATGGGATTTCATCATTTTCATGGGTCCCACATATCTATATACTTTAAAGTTTATTCTTAAAGAGATTATTAATAGCTAAAAATTTCTATAAATCTTTATCATCCAGTTATTT
TGATTAATCAATTATATTAAATGAAAATTCTTTAATTGTGTATTATTAAATTACGATTACTAGAGTTACTGGTATTATATATTTTAAATTACTTGTGAATTGATAAAAAAAGAAATTCTT
TCTGGAAGTACAAGTAATCAATCAGTGTTGCTAAAGCTGCATCATAATACATGCGCATTCACTGTCATGGTCAATGAAGAACCATCGGATCATAGAGTTTTATATCTTATTCAAATTTCC
GCAGCCGCCCACACCCTTGGATTCTCTCACTGCGGCAAGTTCGCCAACAGGATATACAATTTCAGCCGTCAAAACCCAGTGGATCCTACACTGAACAAGGCCTACGCCACTCAGCTACAG
CAAATGTGCCCGAAGAATGTGGACCCCAGGATAGCCATCAACATGGACCCCAAAACACCCCAGACATTTGACAACGCCTACTACAAGAATCTCCAGCAAGGAATGGGCCTCTTCACCTCA
GACCAGATTCTCTTCACCGATGCAAGGTCCAGGCCGACTGTTAATGCATGGGCCAGTAATTCCCCAGCCTTTCAACAAGCCTTTGTTGCGGCGATGACGAAGCTGGGACGGGTCGGAGTC
AAGACGGGTAGAAACGGAAATATCCGCACAGATTGTGGGGTATTAAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATGGGTTGTCTTCGATTTGATGTGATTCTTGTATTTTCACTTTCCCTCAGTTTCTTTCTCTTCTCTAATACAGTATCAGCTCAGCAATTGAGACAGAACTATTATGCCAATATT
TGCCCAAATGTAGAAAGTATAGTTAGAAGTACAGTTCAGAAGAAATTCCAACAGACTTTCGTCACTGTTCCTGCAACCCTCCGTCTCTTCTTCCACGATTGCTTTGTCCAG
GGATGTGAT
GCCTCAGTCGTAGTTGCTTCCACTCCAAACAACAAAGCAGAGAAAGACCATCCTGATAATTTATCACTGGCCGGAGATGGATTTGACACCGTAATCAAGGCTAAAGCCGCCGTGGACGCA
GTCCCCAGCTGCAGAAATAAAGTTTCATGTGCAGATATATTAGCCATGGCAACAAGAGATGTGGTTGCCCTG
TCTGGTGGGCCTTCATATGCTGTTGAATTGGGAAGATTGGATGGTCTA
AGCTCAACCGCTGCTAGTGTTAATGGCAAACTGCCTCAGCCAACTTTTAATTTGAATCAGCTTAATTCTTTGTTTGCTGCTAATGGGCTATCCCAAACTGACATGATTGCTCTTTCAG
CC
GCCCACACCCTTGGATTCTCTCACTGCGGCAAGTTCGCCAACAGGATATACAATTTCAGCCGTCAAAACCCAGTGGATCCTACACTGAACAAGGCCTACGCCACTCAGCTACAGCAAATG
TGCCCGAAGAATGTGGACCCCAGGATAGCCATCAACATGGACCCCAAAACACCCCAGACATTTGACAACGCCTACTACAAGAATCTCCAGCAAGGAATGGGCCTCTTCACCTCAGACCAG
ATTCTCTTCACCGATGCAAGGTCCAGGCCGACTGTTAATGCATGGGCCAGTAATTCCCCAGCCTTTCAACAAGCCTTTGTTGCGGCGATGACGAAGCTGGGACGGGTCGGAGTCAAGACG
GGTAGAAACGGAAATATCCGCACAGATTGTGGGGTATTAAAT

Retrieve as FASTA