Entry information : RcPrx25 (29726.m003967)
Entry ID 9353
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx25 (29726.m003967)
Name (synonym) RcPrx25 (29726.m003967)
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx25
start..stop
S start..stop
MePrx88 330 4e-115 7..196 1..190
MePrx88 81 2e-18 194..238 276..320
MePrx127 330 1e-114 1..196 1..195
MePrx127 78 3e-17 170..237 257..324
LePrx91 301 3e-103 6..196 5..195
LePrx91 82 2e-18 170..237 257..324
EtPrx02 293 3e-102 28..196 6..174
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 477633..477848 216 N° 2 477143..477334 192 N° 3 476754..476923 170 N° 4 476365..476500 136
complement(join(476365..476500,476754..476923,477143..477334,477633..477848))


exon

Literature and cross-references RcPrx25 (29726.m003967)
DNA ref. Phytozome 11:   29726 (477848..476365)
Protein sequence: RcPrx25 (29726.m003967)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   238 (220)
PWM (Da):   %s   25787.4 (23766.3) Transmb domain:   %s   o5-27i
PI (pH):   %s   8.32 (8.21) Peptide Signal:   %s   cut: 19 range:19-238
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSSLVLLLLFCVALVYQVGVCCGGGLRKNFYKDTCPQAEGIVRSIIWKRVSANSTLPAKLLRMHFHDCFVRGCDASVLLDSTPKNSAEKAAIPNLSLGGFDVIDEVKSKLETTCPGVVSCADIVALAARDSVSFQFKKPIWEVLTGRRDGLISRASEALADIPSPFFNFSLLKQSFANKSLTVHDLVVLSGYDIIDELLDSGKFFTEFAQSMKRMGAIDVLTGSAGEIRKKCNVVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (A long sequence in frame is missing due to 'NNNN' and bad sequencing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGTAGCTTAGTTCTGCTGTTGTTGTTCTGTGTTGCATTAGTGTATCAAGTAGGAGTTTGCTGTGGAGGGGGATTAAGAAAAAACTTTTACAAGGATACTTGTCCTCAAGCTGAG
GGTATTGTAAGGAGTATCATTTGGAAACGTGTCTCTGCCAATTCGACATTGCCTGCAAAGCTTTTAAGGATGCATTTTCACGACTGTTTTGTCAGG
GTAAACATATATATATATATACAT
ATATTATTGCTATAGAAAATTAACTGGTGTTAGAACTTATTTGGTTAAAAGTGAAATACTAACATATGCCTCACAGAAAATAATTATTTTATATAATAAATTATTACGCCTGTATATGTT
ATTCCTTGTGTACGTAAGTTATACTCACACACAGAAGCAGATTATAAGAAAAGAGTATATGTGCACATTCAATCTCCCCATATTGGGTTAAATATATTATCTTGAATAACAACAATAGAT
ATGAATATTTTTTGTTATGGCTATGCTTTGGCAGGGCTGTGATGCATCCGTATTGCTGGATTCCACACCCAAGAACTCAGCTGAAAAGGCAGCAATTCCAAACCTGTCTCTAGGAGGTTT
CGATGTCATAGATGAGGTGAAGAGCAAGCTAGAGACGACATGCCCTGGAGTTGTCTCTTGTGCAGATATTGTTGCTCTAGCTGCTAGAGATTCTGTTTCCTTCCAA
GTAAGTTAATTCTA
TATTTTTTAAACTAACTAGTAAACTGTGTATGTCAGAGATACTAAATTATTTATTATACATGTGGTTCAAACTACTAATTCTTAGTCCAGTGGCCAAAGACGAGCTAGTTCTAATCGAGT
CCCACCCTTCTTTCCCCAATATACTTCTAAGCAAAATTCTTTATCTAATTTGCATGATTTGGTTTTGGTTGTTTGGTGATTGCAGTTTAAAAAGCCAATTTGGGAAGTGCTAACTGGTAG
AAGAGATGGATTAATTTCCAGAGCATCGGAGGCTCTAGCGGATATCCCTTCACCTTTCTTTAATTTTTCCCTTCTCAAACAGTCTTTTGCCAACAAAAGCTTAACGGTCCATGACCTTGT
CGTTTTATCAGGTTA
GTAATAAGTATAATATACTCAATCTATCACGATATTTATAGAAAAATTGAATTAAATATTAATGAGTAATTCAAAGTTAATTAATTACGGACACAGCTACTACAT
ACCAATTAGACTACTAATTGATGTTTAAGTCATAATTTTTATTAATAATTTTTGGTCAGGTGGACACACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNGCTCAGCGATATCATTGACGAGTTGCTTGATTCAGGCAAGTTCTTCACCGAGTTTGCACAATCCATGAAGAGGATGGGAGCAATTGACGTGCTCACTG
GGAGTGCTGGAGAAATTAGGAAGAAATGTAATGTGGTGAATTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGTAGCTTAGTTCTGCTGTTGTTGTTCTGTGTTGCATTAGTGTATCAAGTAGGAGTTTGCTGTGGAGGGGGATTAAGAAAAAACTTTTACAAGGATACTTGTCCTCAAGCTGAG
GGTATTGTAAGGAGTATCATTTGGAAACGTGTCTCTGCCAATTCGACATTGCCTGCAAAGCTTTTAAGGATGCATTTTCACGACTGTTTTGTCAGG
GGCTGTGATGCATCCGTATTGCTG
GATTCCACACCCAAGAACTCAGCTGAAAAGGCAGCAATTCCAAACCTGTCTCTAGGAGGTTTCGATGTCATAGATGAGGTGAAGAGCAAGCTAGAGACGACATGCCCTGGAGTTGTCTCT
TGTGCAGATATTGTTGCTCTAGCTGCTAGAGATTCTGTTTCCTTCCAA
TTTAAAAAGCCAATTTGGGAAGTGCTAACTGGTAGAAGAGATGGATTAATTTCCAGAGCATCGGAGGCTCTA
GCGGATATCCCTTCACCTTTCTTTAATTTTTCCCTTCTCAAACAGTCTTTTGCCAACAAAAGCTTAACGGTCCATGACCTTGTCGTTTTATCAGGTTA
CGATATCATTGACGAGTTGCTT
GATTCAGGCAAGTTCTTCACCGAGTTTGCACAATCCATGAAGAGGATGGGAGCAATTGACGTGCTCACTGGGAGTGCTGGAGAAATTAGGAAGAAATGTAATGTGGTGAATTCT

Retrieve as FASTA