Entry information : RcPrx42 (29842.m003595)
Entry ID 9368
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx42 (29842.m003595)
Name (synonym) RcPrx42 (29842.m003595)
Class Class III peroxidase     [Orthogroup: Prx006]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx42
start..stop
S start..stop
PtPrx02 419 2e-149 1..269 1..331
PbPrx03 419 2e-149 1..269 1..331
PbPrx01 419 2e-149 1..269 1..331
PtrePrx01 414 2e-147 1..269 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 460101..460334 234 N° 2 461152..461317 166 N° 3 461418..461824 407  
join(460101..460334,461152..461317,461418..461824)


exon

Literature and cross-references RcPrx42 (29842.m003595)
DNA ref. Phytozome 12:   29842 (460101..461824)
Protein sequence: RcPrx42 (29842.m003595)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   269 (245)
PWM (Da):   %s   30618.74 (27967.3)  
PI (pH):   %s   8.88 (8.45) Peptide Signal:   %s   cut: 25 range:25-269
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAKALFFFALLFFSAVSFRPAFAEENEEDPGLVMNFYKDTCPQAEDVIKEQVRLLYKRHKNTAFSWLRNIFHDCAVELGGPYIPLKTGRRDGRKSRADVLEQYLPDHNESISVVLERFSAMGIDTPGVVALLGAHSVGRTHCVKLVHRLYPEVDPVLNPNHVEHMLYKCPDAIPDPKAVQYVRNDRGTPMILDNNYYRNILDNKGLLIVDHQLATDKRTKPYVKKMAKSQEYFFKEFSRAITILSENNPLTGTKGEIRKQCNVANKH

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Gaps in frame due to 'NNNNN' in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCAAAGCTCTCTTCTTCTTTGCTTTGTTGTTCTTCTCAGCTGTGTCTTTTAGGCCAGCTTTTGCAGAGGAAAATGAGGAAGACCCAGGTCTTGTTATGAACTTTTACAAGGAC
ACTTGTCCTCAAGCTGAAGACGTTATAAAGGAACAAGTTAGACTTCTTTACAAGAGACACAAGAACACTGCATTTTCATGGCTGAGAAACATCTTCCATGACTGTGCTGTTGAA
GTAAAC
CTCTCCCTTTTTTCTTTTATCGCTGTTTCTTTCTTTTCCTTTTAAGTCTTCTTCGTTCGTTCCTGATGTATGTTTTGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNCTTAATTCTCTAATGGATTTACTTCTTAATACTAGATCTAGAACTTGCTCACCCCCAACTGTAATTAATTTGTTGTCTCCACTTTCAGTAAGGTT
CTGTTTTAGCCTTGTAGGTGTTTCTGACAGAGATTTGTACCGAGTTTGAGACACATCAATTCTGGCAAAATATTTACTCTTCTTTTCAATGAAAAATGACTGGAACTATATGATTTTGAC
TGTTTTACCATCTTATCTACTGTAATGATGTTGATGTTTGAATATTATCTGCTCTTCAGGCTTGAACATAACCTGAATTTCTTGTTTGCAGCTAGGAGGTCCTTACATCCCTCTAAAAAC
TGGAAGAAGAGATGGAAGAAAGAGCAGAGCAGATGTTCTTGAGCAATACCTCCCAGACCACAATGAGAGCATCTCTGTCGTTCTTGAGAGGTTTTCTGCCATGGGTATTGACACACCAGG
AGTCGTTGCCTTGCTAG
GTACAGTTCATAACTTCATATAACCCACTTATTTCACATGCAAATAGACAACAATGAACTAGCTCAATATAAGAGATTAAAAATCTTTTTTGTCTAACAGGAG
CTCATAGTGTGGGTAGAACTCACTGTGTGAAGCTGGTGCACCGTCTCTACCCAGAGGTTGATCCAGTTCTAAACCCTAACCATGTTGAGCACATGCTCTACAAGTGCCCTGATGCAATCC
CAGACCCTAAAGCAGTGCAATATGTCAGAAATGACCGTGGCACACCCATGATTCTTGACAATAACTACTACAGAAATATATTGGACAACAAGGGCTTGTTGATAGTTGATCACCAACTAG
CTACAGACAAGAGGACAAAGCCTTATGTCAAGAAAATGGCCAAGAGCCAGGAGTATTTCTTTAAGGAATTTTCTAGGGCTATCACCATTCTTTCTGAGAACAACCCGCTCACTGGTACTA
AAGGTGAGATCAGAAAGCAGTGCAATGTTGCTAACAAGCACCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCAAAGCTCTCTTCTTCTTTGCTTTGTTGTTCTTCTCAGCTGTGTCTTTTAGGCCAGCTTTTGCAGAGGAAAATGAGGAAGACCCAGGTCTTGTTATGAACTTTTACAAGGAC
ACTTGTCCTCAAGCTGAAGACGTTATAAAGGAACAAGTTAGACTTCTTTACAAGAGACACAAGAACACTGCATTTTCATGGCTGAGAAACATCTTCCATGACTGTGCTGTTGAA
CTAGGA
GGTCCTTACATCCCTCTAAAAACTGGAAGAAGAGATGGAAGAAAGAGCAGAGCAGATGTTCTTGAGCAATACCTCCCAGACCACAATGAGAGCATCTCTGTCGTTCTTGAGAGGTTTTCT
GCCATGGGTATTGACACACCAGGAGTCGTTGCCTTGCTAG
GAGCTCATAGTGTGGGTAGAACTCACTGTGTGAAGCTGGTGCACCGTCTCTACCCAGAGGTTGATCCAGTTCTAAACCCT
AACCATGTTGAGCACATGCTCTACAAGTGCCCTGATGCAATCCCAGACCCTAAAGCAGTGCAATATGTCAGAAATGACCGTGGCACACCCATGATTCTTGACAATAACTACTACAGAAAT
ATATTGGACAACAAGGGCTTGTTGATAGTTGATCACCAACTAGCTACAGACAAGAGGACAAAGCCTTATGTCAAGAAAATGGCCAAGAGCCAGGAGTATTTCTTTAAGGAATTTTCTAGG
GCTATCACCATTCTTTCTGAGAACAACCCGCTCACTGGTACTAAAGGTGAGATCAGAAAGCAGTGCAATGTTGCTAACAAGCACCAC

Retrieve as FASTA