Entry information : RcPrx52 (29957.m001418)
Entry ID 9375
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx52 (29957.m001418)
Name (synonym) RcPrx52 (29957.m001418)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx52
start..stop
S start..stop
MePrx20 567 0 1..317 11..329
PtPrx40 531 0 1..317 45..360
CclPrx113 510 0 1..317 1..318
CclPrx84 493 5e-178 1..317 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 599477..599683 207 N° 2 598336..598530 195 N° 3 598090..598255 166 N° 4 597612..597994 383
complement(join(597612..597994,598090..598255,598336..598530,599477..599683))


exon

Literature and cross-references RcPrx52 (29957.m001418)
DNA ref. Phytozome 11:   29957 (599683..597612)
Protein sequence: RcPrx52 (29957.m001418)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (295)
PWM (Da):   %s   33992.79 (31475.5)  
PI (pH):   %s   6.23 (6.23) Peptide Signal:   %s   cut: 23 range:23-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSSLIYGLYLYMLLFSLGYAQLSPNYYATTCPKALSTIRTAVHNAVVKEHRMGASLLRMHFHDCFVNGCDASVLLDDISPSFTGEKTAGPNANSLRGFDVIDTIKSQVESICPGVVSCADILAVAARDSVVALGGPSWQVELGRRDSTTASYDAANTDLPSPLMDLSDLISALSRKGFTAKEMVALAGSHTIGQARCLMFRGRLYNETNIDSALATSLKSDCPTTGSDDNLSPLDATSPVIFDNSYFKNLVNNKGLLHSDQQLFSGGSTNSQVKTYSTDPFTFYADFANAMIKMGKLSPLTGTDGQIRTDCRKV

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTTTCTTCATTAATCTATGGATTATATTTATATATGCTCTTGTTTAGCTTAGGGTATGCACAATTGTCCCCCAATTACTATGCCACAACATGCCCAAAAGCCCTTTCTACCATT
AGAACAGCCGTGCACAATGCTGTTGTCAAGGAGCACCGCATGGGGGCATCTTTGCTTCGCATGCATTTCCATGACTGCTTTGTTAAT
GTACTCTCTCCCTCTTTTGTACATTGAACATTT
GTTCAACTTTTACTTTCTTTTTGTTTTTAATCATGTGTTGGTGTTTAAGGGATTTGTAGAAATGTATGTGTGATTATATAAGAGCATGCATGGAAAGACGATAGAAGAGTTACAATGAGA
TGTTCAAGTGATTCAATAACTTATGCATGCATATATTAATACCACTACTATAGGTGCTCAAGGGTCAAGTTGGCTCCCAAATTATTTTTCAAGGTCCAGCTCGCTCTAAAACTGATTGGC
CAATTTACACTAGAACTTTCTATTTTTTGGTCCAATTTACCCCCAAAACCTTGGCGTGAAAGCTTCGAGTTGTTCCTTCATCCTTTGATGATGGCAATGGTCCATTTCCAAAGGAACTGA
AGTTACATATCTTTCCTATTTCCATTTAAGTTCTTATGTGTAATATCTCTTGAGACCTCGAAAAATGGATGATTTCCTTTTCTTTCGAACACTTCCATGCCCCTTGAAGCCCCAAAAAAA
TGGATAAATTCCTTATGAACAAGTATAAACTTGGTCCTAAATGACTTGGCTTTACTTAGGTATTCTAAAGAGTGCAGCTCGTGTTTTAGTTTCACCGGCAACAACGATATCTAGAAGATA
ATATCGAGGGGCAAATGGTCTCTTTGAATTTCTTTAGCTGGTTTAGATAGTTTTTAAAGGATTGGAATATAAGGATGAATTTCCCACTTTATGAGCTTCATTCCGAAAAGAATATTCATT
CTGATCCGGCGACATTTATGATCGAATTGGGGCAAATTACACCACAAATAAAAAGTTGCGATGTAAATTAACCAAGAAAATTTGATTTTGGAGTGAATTTAACCTTAGAAAATGCTTTCC
GAGTCAAGTTGACCCTTTAGCCCTCTTCTCTTTTATATGTTATTTTGACGAAATTGTGTATTGCCTTGAACAGGGATGCGATGCATCAGTCTTATTAGATGACATCTCACCAAGTTTCAC
TGGAGAGAAGACTGCAGGCCCAAATGCAAATTCTCTGAGAGGTTTTGATGTGATTGACACTATTAAATCACAAGTCGAATCCATTTGCCCTGGTGTAGTTTCTTGTGCTGATATTCTTGC
TGTTGCTGCTCGAGACTCAGTTGTTGCT
GTAAGTAAAGAGCATATCTCTTACCCATGAGGCATGCTATCAATCATTTCTCTGATTAATACTCACAATTGGCTGTCCAGTTGGGTGGTCCC
TCATGGCAAGTTGAGTTGGGCAGAAGAGACTCCACCACTGCAAGTTATGATGCTGCAAACACAGATCTTCCATCCCCACTAATGGATCTCAGTGACCTTATATCTGCCTTATCACGCAAA
GGATTCACTGCCAAAGAAATGGTTGCACTTGCTG
GTAGAATGGATATATCTAATGATTCAAAATTTTATAGCATTACCTTGAAATTTAGTTTTGTTGAAAACTGATGTATAGATGCATTT
CATGAGTAGGATCTCACACAATAGGCCAAGCCAGGTGCTTGATGTTCCGGGGCAGACTCTACAATGAGACCAACATTGATTCAGCACTAGCAACATCACTAAAATCTGATTGTCCGACCA
CAGGCAGTGATGACAATCTCTCTCCACTAGATGCTACTAGCCCTGTCATATTTGATAATAGCTATTTCAAGAACTTGGTAAACAACAAAGGCCTTCTGCACTCAGATCAGCAGCTTTTCA
GTGGTGGCTCCACCAATTCACAGGTGAAAACCTATAGCACAGATCCTTTTACTTTTTATGCAGATTTTGCCAATGCCATGATCAAGATGGGGAAACTTAGTCCGCTAACAGGAACTGATG
GGCAGATTCGAACCGACTGCCGGAAAGTAAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTTTCTTCATTAATCTATGGATTATATTTATATATGCTCTTGTTTAGCTTAGGGTATGCACAATTGTCCCCCAATTACTATGCCACAACATGCCCAAAAGCCCTTTCTACCATT
AGAACAGCCGTGCACAATGCTGTTGTCAAGGAGCACCGCATGGGGGCATCTTTGCTTCGCATGCATTTCCATGACTGCTTTGTTAAT
GGATGCGATGCATCAGTCTTATTAGATGACATC
TCACCAAGTTTCACTGGAGAGAAGACTGCAGGCCCAAATGCAAATTCTCTGAGAGGTTTTGATGTGATTGACACTATTAAATCACAAGTCGAATCCATTTGCCCTGGTGTAGTTTCTTGT
GCTGATATTCTTGCTGTTGCTGCTCGAGACTCAGTTGTTGCT
TTGGGTGGTCCCTCATGGCAAGTTGAGTTGGGCAGAAGAGACTCCACCACTGCAAGTTATGATGCTGCAAACACAGAT
CTTCCATCCCCACTAATGGATCTCAGTGACCTTATATCTGCCTTATCACGCAAAGGATTCACTGCCAAAGAAATGGTTGCACTTGCTG
GATCTCACACAATAGGCCAAGCCAGGTGCTTG
ATGTTCCGGGGCAGACTCTACAATGAGACCAACATTGATTCAGCACTAGCAACATCACTAAAATCTGATTGTCCGACCACAGGCAGTGATGACAATCTCTCTCCACTAGATGCTACTAGC
CCTGTCATATTTGATAATAGCTATTTCAAGAACTTGGTAAACAACAAAGGCCTTCTGCACTCAGATCAGCAGCTTTTCAGTGGTGGCTCCACCAATTCACAGGTGAAAACCTATAGCACA
GATCCTTTTACTTTTTATGCAGATTTTGCCAATGCCATGATCAAGATGGGGAAACTTAGTCCGCTAACAGGAACTGATGGGCAGATTCGAACCGACTGCCGGAAAGTAAAC

Retrieve as FASTA