Entry information : RcPrx54 (29989.m000432)
Entry ID 9377
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx54 (29989.m000432)
Name (synonym) RcPrx54 (29989.m000432)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx54
start..stop
S start..stop
MePrx31 589 0 1..324 1..321
PalPrx08 560 0 1..324 1..324
PtPrx75 558 0 19..324 1..306
GhPrx06 542 0 1..324 6..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 234844..235233 390 N° 2 234349..234511 163 N° 3 233808..234226 419  
complement(join(233808..234226,234349..234511,234844..235233))


exon

Literature and cross-references RcPrx54 (29989.m000432)
DNA ref. Phytozome 12:   29989 (235233..233808)
Protein sequence: RcPrx54 (29989.m000432)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (302)
PWM (Da):   %s   34750.51 (32319.3)  
PI (pH):   %s   7.89 (7.99) Peptide Signal:   %s   cut: 23 range:23-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMQYLLVFLCLSCMVSTLVQGQGTRVGFYSTTCPQAESIVRTTVQSHFNSNPTIAPGLLRMHFHDCFVQGCDASILIDGSNTEKTALPNLLLRGYDVIDDAKTKLEASCPGVVSCADILALAARDSVVLTNGPTWPVPTGRRDGRVSLASDAANLPGFTDSIDVQKQKFAALGLNTQDLVTLVGGHTIGTTACQFFSYRLYNFTTTGNGADPSIDPAFVPQLQALCPQNGDASKRIALDTGSSNRFDGTFFSNLRSGRGILESDQKLWTDTTTRTFVQRFLGIRGLAGLTFNIEFARSMIKMSNIGVKTGTNGEIRKLCSAI

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGCAATATTTGTTAGTGTTTCTTTGCCTTAGCTGCATGGTTAGCACCCTGGTGCAAGGCCAAGGCACTAGAGTTGGATTTTATTCCACAACATGTCCTCAGGCTGAATCCATT
GTCAGGACAACAGTCCAGTCTCATTTCAACTCTAACCCTACTATTGCACCTGGGTTACTCAGGATGCACTTCCATGACTGCTTTGTGCAGGGGTGTGATGCTTCAATCCTCATTGATGGA
TCCAACACAGAGAAAACAGCTCTACCAAATCTTCTACTTAGAGGATATGATGTCATTGATGATGCTAAGACCAAGCTTGAAGCTTCATGTCCTGGAGTTGTTTCCTGTGCTGACATTCTA
GCCCTTGCTGCCCGTGACTCTGTTGTTTTG
GTATGCATATTTAGTTTGGCTCCATTTATGCAGCTTTGCCTTTTTCTTCTTTTCTTTTTTGTGCTTATTTAATTTTACCATATATGTCTC
GGAGTTAGCCCACTCTCAAACAAATATTCTATACTAGTTTAATACTTTTAAAACACCTCTACGTAAATGCTTTTCATATTTTAAGCATAAATAACCACATATAAAAGTAACTGAAGTTGA
ACTCTAGTTCTTTCGATCGTAGAGGCTTTAATACCGTGTAAAAGTACTAAATTGTTAAATGATAAAATTAGCTTTACATCTCTAACAGACACTAAAAATGCTTATTTGTGTTGATTATTT
AGACAAATGGACCGACTTGGCCTGTACCCACTGGACGCAGAGATGGTAGGGTTTCATTAGCATCCGATGCTGCAAATTTGCCTGGATTCACCGACTCAATTGATGTACAAAAGCAGAAAT
TTGCAGCTTTGGGTCTCAACACTCAAGACCTTGTCACCCTTGTCG
GTAAGATTTTTCATTTTCTTTTTTCTTCTGTATAAATATATATATATATATATATATATATATTACAAGATAAAC
ACCTGATTATTATAATACACTAACTTCCATTTGATTTTTGTTAATAGGTGGACATACTATAGGAACTACAGCTTGCCAATTCTTCAGTTATAGACTATATAATTTCACTACAACTGGAAA
TGGTGCTGACCCATCCATCGACCCAGCCTTCGTTCCTCAACTACAGGCACTTTGCCCACAAAATGGCGATGCTTCAAAACGGATAGCACTGGACACAGGCAGCTCCAATAGGTTTGATGG
AACTTTCTTCTCAAACTTGAGGAGTGGCAGAGGCATACTTGAATCTGACCAAAAGTTATGGACTGATACCACAACAAGAACCTTCGTGCAACGTTTCTTAGGTATTAGAGGGTTGGCTGG
CTTGACCTTTAACATAGAATTTGCGAGGTCCATGATCAAGATGAGTAATATTGGTGTTAAAACTGGTACCAATGGTGAAATTCGCAAATTATGTTCTGCCATCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGCAATATTTGTTAGTGTTTCTTTGCCTTAGCTGCATGGTTAGCACCCTGGTGCAAGGCCAAGGCACTAGAGTTGGATTTTATTCCACAACATGTCCTCAGGCTGAATCCATT
GTCAGGACAACAGTCCAGTCTCATTTCAACTCTAACCCTACTATTGCACCTGGGTTACTCAGGATGCACTTCCATGACTGCTTTGTGCAGGGGTGTGATGCTTCAATCCTCATTGATGGA
TCCAACACAGAGAAAACAGCTCTACCAAATCTTCTACTTAGAGGATATGATGTCATTGATGATGCTAAGACCAAGCTTGAAGCTTCATGTCCTGGAGTTGTTTCCTGTGCTGACATTCTA
GCCCTTGCTGCCCGTGACTCTGTTGTTTTG
ACAAATGGACCGACTTGGCCTGTACCCACTGGACGCAGAGATGGTAGGGTTTCATTAGCATCCGATGCTGCAAATTTGCCTGGATTCACC
GACTCAATTGATGTACAAAAGCAGAAATTTGCAGCTTTGGGTCTCAACACTCAAGACCTTGTCACCCTTGTCG
GTGGACATACTATAGGAACTACAGCTTGCCAATTCTTCAGTTATAGA
CTATATAATTTCACTACAACTGGAAATGGTGCTGACCCATCCATCGACCCAGCCTTCGTTCCTCAACTACAGGCACTTTGCCCACAAAATGGCGATGCTTCAAAACGGATAGCACTGGAC
ACAGGCAGCTCCAATAGGTTTGATGGAACTTTCTTCTCAAACTTGAGGAGTGGCAGAGGCATACTTGAATCTGACCAAAAGTTATGGACTGATACCACAACAAGAACCTTCGTGCAACGT
TTCTTAGGTATTAGAGGGTTGGCTGGCTTGACCTTTAACATAGAATTTGCGAGGTCCATGATCAAGATGAGTAATATTGGTGTTAAAACTGGTACCAATGGTGAAATTCGCAAATTATGT
TCTGCCATCAAC

Retrieve as FASTA