Entry information : RcPrx57 (30015.m000223)
Entry ID 9380
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx57 (30015.m000223)
Name (synonym) RcPrx57 (30015.m000223)
Class Class III peroxidase    [Orthogroup: Prx041]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx57
start..stop
S start..stop
MePrx101 499 3e-180 1..319 1..318
RcPrx56 495 1e-178 4..319 5..320
MePrx81 486 6e-175 1..319 1..320
PtPrx74 481 4e-173 12..319 14..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 141811..142023 213 N° 2 142119..142313 195 N° 3 142453..143001 549  
join(141811..142023,142119..142313,142453..143001)


exon

Literature and cross-references RcPrx57 (30015.m000223)
DNA ref. Phytozome 12:   30015 (141811..143001)
Protein sequence: RcPrx57 (30015.m000223)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (297)
PWM (Da):   %s   34415.79 (32292.7) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.45 (4.45) Peptide Signal:   %s   cut: 23 range:23-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSGCYLCGLLLLLAIAATASSTLSPSYYDQVCPNALTTIKRVVEAAVSRERRMGASLLRLHFHDCFVNGCDASLLLDSSPSIDSEKNAAPNVNSARGFEVIDQIKSEVDEVCGRPAVSCADILAVAARDSVVALGGPTWEVQLGRRDSTSASRTMADTDIPSPFMDLPALIEKFKNQGLDEEDLVALSGAHTLGFAQCRVFRNRIYNESNDIDPEFAEQRRSSCPGTGGDANLSPLDPTPAYFDISYFTNLKNNKGLLHSDQQLFSGGSTDEIVLSYNSDAEEFWEDFAESMVKMGNIKPLTGNQGQVRLNCRNVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAAGTAGCGGCTGCTATCTTTGTGGTTTACTACTTCTGTTGGCTATTGCTGCAACTGCTTCTTCAACACTATCTCCGTCTTACTATGATCAAGTCTGTCCCAATGCTTTAACC
ACTATTAAACGTGTTGTCGAGGCTGCGGTTTCTAGAGAACGACGAATGGGTGCTTCTTTGTTGCGCCTGCATTTCCATGACTGTTTTGTTAAT
GTACTTACGTAGACTAATCACCTTAGT
TTAAGCTTTTACTTTATATGCTTCAATTCTCTTCTTAAATTTGAAATTCTTCCTGTCGTATGTTACAGGGTTGTGATGCTTCACTTCTTTTGGATTCTTCTCCCTCTATTGATAGTGAAA
AAAATGCTGCTCCTAATGTAAATTCTGCAAGAGGATTTGAAGTTATTGACCAGATTAAATCAGAGGTGGACGAAGTATGTGGACGCCCAGCAGTTTCTTGCGCAGACATCCTAGCGGTTG
CAGCTCGGGATTCCGTAGTTGCG
GTACTATATATATGTTTGTTCATCCCTTTTTGTTCTTTAATTCAAAGAATTAATTGATCGTCGTTAACTAAGGCTAAGAATAGTTTAATATATACTT
ATAATGGTAGTAATAACATATGAATATAACAAATGTATGCAGCTAGGGGGTCCAACATGGGAAGTGCAGCTTGGAAGAAGAGACTCAACATCAGCTAGTAGAACAATGGCAGACACAGAT
ATTCCATCACCATTTATGGACCTTCCTGCACTTATTGAAAAATTCAAGAACCAAGGTCTTGACGAGGAAGATCTTGTTGCACTTTCTGGTGCCCACACTTTAGGATTTGCACAATGTCGT
GTATTCAGAAATAGAATATACAATGAATCAAATGATATTGACCCGGAATTTGCAGAGCAACGAAGATCAAGCTGTCCAGGAACAGGTGGTGACGCGAACCTTTCGCCTCTAGACCCAACA
CCTGCATATTTTGACATTTCGTACTTCACTAATTTGAAAAATAATAAAGGGCTGCTTCACTCTGACCAGCAACTCTTCAGTGGTGGATCGACTGATGAAATAGTGTTGAGCTATAATTCA
GATGCAGAAGAGTTTTGGGAGGATTTTGCTGAGTCTATGGTTAAGATGGGGAATATTAAACCATTGACAGGAAATCAAGGCCAAGTTCGTTTGAACTGCAGGAATGTAAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAAGTAGCGGCTGCTATCTTTGTGGTTTACTACTTCTGTTGGCTATTGCTGCAACTGCTTCTTCAACACTATCTCCGTCTTACTATGATCAAGTCTGTCCCAATGCTTTAACC
ACTATTAAACGTGTTGTCGAGGCTGCGGTTTCTAGAGAACGACGAATGGGTGCTTCTTTGTTGCGCCTGCATTTCCATGACTGTTTTGTTAAT
GGTTGTGATGCTTCACTTCTTTTGGAT
TCTTCTCCCTCTATTGATAGTGAAAAAAATGCTGCTCCTAATGTAAATTCTGCAAGAGGATTTGAAGTTATTGACCAGATTAAATCAGAGGTGGACGAAGTATGTGGACGCCCAGCAGTT
TCTTGCGCAGACATCCTAGCGGTTGCAGCTCGGGATTCCGTAGTTGCG
CTAGGGGGTCCAACATGGGAAGTGCAGCTTGGAAGAAGAGACTCAACATCAGCTAGTAGAACAATGGCAGAC
ACAGATATTCCATCACCATTTATGGACCTTCCTGCACTTATTGAAAAATTCAAGAACCAAGGTCTTGACGAGGAAGATCTTGTTGCACTTTCTGGTGCCCACACTTTAGGATTTGCACAA
TGTCGTGTATTCAGAAATAGAATATACAATGAATCAAATGATATTGACCCGGAATTTGCAGAGCAACGAAGATCAAGCTGTCCAGGAACAGGTGGTGACGCGAACCTTTCGCCTCTAGAC
CCAACACCTGCATATTTTGACATTTCGTACTTCACTAATTTGAAAAATAATAAAGGGCTGCTTCACTCTGACCAGCAACTCTTCAGTGGTGGATCGACTGATGAAATAGTGTTGAGCTAT
AATTCAGATGCAGAAGAGTTTTGGGAGGATTTTGCTGAGTCTATGGTTAAGATGGGGAATATTAAACCATTGACAGGAAATCAAGGCCAAGTTCGTTTGAACTGCAGGAATGTAAAT

Retrieve as FASTA