Entry information : RcPrx70 (30156.m001760)
Entry ID 9392
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx70 (30156.m001760)
Name (synonym) RcPrx70 (30156.m001760)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx70
start..stop
S start..stop
RcPrx[P]69 601 0 1..327 1..319
MePrx93 546 0 5..327 4..328
PtPrx25 534 0 3..327 2..324
PtPrx27 516 0 1..327 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1503301..1503513 213 N° 2 1503005..1503202 198 N° 3 1502595..1502754 160 N° 4 1502031..1502440 410
complement(join(1502031..1502440,1502595..1502754,1503005..1503202,1503301..1503 513))


exon

Literature and cross-references RcPrx70 (30156.m001760)
DNA ref. Phytozome 12:   30156 (1503513..1502031)
Protein sequence: RcPrx70 (30156.m001760)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   35542.92 (32991.5) Transmb domain:   %s   i5-22o
PI (pH):   %s   6.39 (6.39) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRGNIGYLGLIIFGLLAFTISTEAQLQMNFYAKSCPKAEKIVSDFVDEHIHNAPSLAASFIRMHFHDCFVRGCDASVLLNSSSTAGEQPEKAAVPNRTLRGFDFIDRVKSLVEDECPGVVSCADIITLVTRDSIVATGGPFWQVPTGRRDGVISRSSEATAIPAPFANITTLQTLFANQGLDLKDLVLLSGAHTIGIAHCSTISDRLYNFSGTGQADPNLDSEYADNLKARKCRSPDDTTTKIEMDPGSRKTFDLSYYSLLLKRRGLFESDAALTTNSVTLSFINQILKGSLQDFFAEFANSMEKMGRINVKTGSDGEIRKHCAVV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGGGAACATCGGGTATTTGGGTCTGATCATCTTTGGTCTTTTAGCATTTACAATCTCAACTGAAGCTCAACTGCAGATGAACTTTTATGCTAAAAGCTGCCCAAAAGCTGAGAAG
ATTGTTTCTGACTTTGTCGATGAGCACATCCACAATGCTCCTTCTTTGGCAGCATCCTTCATAAGAATGCACTTCCATGATTGTTTTGTCAGG
GTTTGTCTCCTAATTCTTCAATTCAAC
TTATTTCATTCTCTCTCTCTTTCTTGCTTATCAGTAACTGGAGTATGGCGATGTTTATATTTGTGTGTCAGGGCTGTGATGCATCTGTGCTTTTAAACTCATCGTCGACTGCCGGCGAAC
AACCCGAAAAGGCTGCTGTCCCAAATCGAACACTAAGAGGCTTTGACTTCATTGACAGAGTGAAGAGCTTGGTTGAAGATGAATGTCCAGGCGTTGTTTCTTGTGCAGATATTATTACTC
TGGTCACTAGGGACTCCATAGTTGCCACA
GTATGTGATTTAATATGTTTATGTATAATATTCTTGAGAAATAAAACTTGCATTAGAAAGAGCTAAACTTGCTCAACAGCAGGAACATTGC
TTTGTTCAACAGGAATTTTTGTCTTTATATTACATTTGTAGGACCAAAGCAATGGAGCAAAGTATAGGTCCTATAACAGTAACCATTAGTGCATGTTTTCAAGATTTCTATATATATAAA
ATAGTTATATCTTCTTCTTAATTCCTTTTATGTGGATAGGGAGGTCCATTCTGGCAAGTTCCAACTGGTAGAAGAGATGGAGTAATATCAAGATCCTCAGAGGCCACAGCCATCCCAGCT
CCCTTTGCCAACATCACCACTCTCCAAACACTGTTTGCCAACCAAGGACTTGATCTGAAAGACCTTGTCTTGCTCTCTG
GTAATTCCTGAACATACCCATCACATCCTTACATTTTTCTT
TTTCAGACGAAACATGTAAACCTACTGTAGTATGTATTAAGAATAAGCAAATGTCATATATTTTTATATGGAATCACTGCCTGACGCATAAACCTGGTTGGCTGAAATTTCAGGGGCACA
CACAATTGGGATCGCCCACTGCTCAACAATTTCGGACAGATTGTATAACTTCAGTGGGACTGGTCAGGCAGATCCAAATCTAGATAGTGAATATGCTGACAATCTCAAGGCAAGGAAGTG
CAGGAGTCCTGATGACACTACTACTAAGATTGAGATGGATCCTGGGAGTCGCAAGACATTTGATCTTAGCTATTACTCACTTCTACTTAAAAGAAGGGGTCTCTTTGAATCTGATGCTGC
CTTGACCACAAATTCTGTTACCCTGTCTTTTATTAACCAGATACTCAAGGGTTCACTACAAGATTTCTTTGCAGAGTTTGCCAACTCCATGGAGAAAATGGGTAGGATCAATGTTAAAAC
TGGGTCTGATGGTGAAATTAGGAAGCATTGTGCAGTGGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGGGAACATCGGGTATTTGGGTCTGATCATCTTTGGTCTTTTAGCATTTACAATCTCAACTGAAGCTCAACTGCAGATGAACTTTTATGCTAAAAGCTGCCCAAAAGCTGAGAAG
ATTGTTTCTGACTTTGTCGATGAGCACATCCACAATGCTCCTTCTTTGGCAGCATCCTTCATAAGAATGCACTTCCATGATTGTTTTGTCAGG
GGCTGTGATGCATCTGTGCTTTTAAAC
TCATCGTCGACTGCCGGCGAACAACCCGAAAAGGCTGCTGTCCCAAATCGAACACTAAGAGGCTTTGACTTCATTGACAGAGTGAAGAGCTTGGTTGAAGATGAATGTCCAGGCGTTGTT
TCTTGTGCAGATATTATTACTCTGGTCACTAGGGACTCCATAGTTGCCACA
GGAGGTCCATTCTGGCAAGTTCCAACTGGTAGAAGAGATGGAGTAATATCAAGATCCTCAGAGGCCACA
GCCATCCCAGCTCCCTTTGCCAACATCACCACTCTCCAAACACTGTTTGCCAACCAAGGACTTGATCTGAAAGACCTTGTCTTGCTCTCTG
GGGCACACACAATTGGGATCGCCCACTGC
TCAACAATTTCGGACAGATTGTATAACTTCAGTGGGACTGGTCAGGCAGATCCAAATCTAGATAGTGAATATGCTGACAATCTCAAGGCAAGGAAGTGCAGGAGTCCTGATGACACTACT
ACTAAGATTGAGATGGATCCTGGGAGTCGCAAGACATTTGATCTTAGCTATTACTCACTTCTACTTAAAAGAAGGGGTCTCTTTGAATCTGATGCTGCCTTGACCACAAATTCTGTTACC
CTGTCTTTTATTAACCAGATACTCAAGGGTTCACTACAAGATTTCTTTGCAGAGTTTGCCAACTCCATGGAGAAAATGGGTAGGATCAATGTTAAAACTGGGTCTGATGGTGAAATTAGG
AAGCATTGTGCAGTGGTTAAT

Retrieve as FASTA