Entry information : RcPrx71 (30156.m001761)
Entry ID 9393
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx71 (30156.m001761)
Name (synonym) RcPrx71 (30156.m001761)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx71
start..stop
S start..stop
MePrx24 593 0 2..324 5..326
MePrx25 574 0 1..324 4..326
PtPrx27 554 0 4..324 7..327
PtPrx26 548 0 2..324 5..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1510195..1510395 201 N° 2 1509869..1510063 195 N° 3 1509584..1509746 163 N° 4 1509056..1509468 413
complement(join(1509056..1509468,1509584..1509746,1509869..1510063,1510195..1510 395))


exon

Literature and cross-references RcPrx71 (30156.m001761)
DNA ref. Phytozome 12:   30156 (1510395..1509056)
Protein sequence: RcPrx71 (30156.m001761)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (304)
PWM (Da):   %s   34705.3 (32546.3)  
PI (pH):   %s   7.06 (7.41) Peptide Signal:   %s   cut: 21 range:21-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVFGVYFFAFLAYMGSAEAQLQMGFYSKSCPRAEQIVQGFVNQHIHNAPSLAATFIRMHFHDCFVRGCDASVLLNSSSSGNQTEKSATPNLTLRGFGFIDSVKSLLEAECPGVVSCADVIALVARDSIVATGGPSWRVPTGRRDGTVSMASEALNNIPPPTSNLTTLQRLFANVGLDLKDLVLLSGAHTIGIAHCPSFSNRLYNFTGVGDQDPALDSEYAAVLKARKCTTPNDNTTIVEMDPGSRKTFDLSYYSNLLKRRGLFQSDSALTTSSATLSTINQLLSGSLENFFAEFAASIEKMGQINVKTGSAGEIRKQCAFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGTGTTTGGGGTGTACTTCTTTGCTTTTTTAGCATATATGGGGTCAGCTGAAGCTCAACTCCAGATGGGTTTTTATTCTAAAAGCTGTCCAAGAGCTGAGCAAATTGTGCAAGGC
TTTGTTAACCAGCATATCCATAATGCTCCATCTCTTGCTGCTACTTTTATAAGAATGCATTTTCATGATTGTTTTGTCAGG
GTATGTCCCTGTTTCCATAGATAGTAAAGCTTATATATA
TATATACAATTGCTTTCCTTTTTTCTGTTTTTCCTCTTAAGGTTTGAGAGGTTAAACTGATAATATGTTTTGTTTTATATATGATTTTTCAGGGTTGTGATGCATCTGTGCTTTTGAATT
CATCATCTTCAGGCAATCAAACTGAAAAAAGTGCAACTCCAAATTTAACACTCAGAGGCTTTGGTTTTATTGACAGTGTTAAGAGCCTATTAGAAGCAGAGTGCCCCGGTGTTGTGTCTT
GTGCTGATGTTATTGCTCTGGTTGCAAGAGATTCTATTGTGGCCACT
GTAAGAAAGGATGACTGCCCAAAATTTATATTCAAAACTAACCCTTACCCATTTTAGGTTTGGCTCAGTATTT
ACCAAAAATGAAGCCTTAATTTGTGTTAAATTATTCTTGGCTTTAACAGGGCGGTCCCTCCTGGAGAGTCCCAACAGGGCGAAGAGATGGAACTGTCTCAATGGCCTCAGAGGCCTTGAA
CAACATCCCACCTCCAACTAGCAATTTGACTACTCTCCAAAGACTATTTGCTAATGTGGGACTGGACCTCAAAGACCTTGTCTTGCTATCCG
GTAAATCATCTTTTTGTCAGTGTTCACA
GTAATATTTGTGCAGTAGAGGTTTATGTTCTTCCTAGAATATAAATGTTTGGATATTCATCATCTTCCGAATGGTTGACAAATTCAGGTGCCCACACAATTGGAATAGCTCATTGCCCAT
CATTTTCGAACCGCCTATACAATTTCACTGGAGTAGGGGATCAAGACCCAGCCCTAGACAGTGAATATGCAGCAGTTCTCAAGGCAAGAAAGTGCACAACTCCGAATGACAATACCACAA
TTGTTGAGATGGATCCTGGAAGTCGCAAAACATTTGATCTCAGCTACTACTCAAATTTACTAAAGAGAAGAGGACTTTTCCAATCAGATTCTGCTCTGACCACAAGCTCAGCTACATTGT
CCACAATTAACCAGCTGCTCAGTGGTTCACTTGAGAATTTCTTTGCTGAATTTGCTGCTTCAATTGAGAAAATGGGCCAAATTAATGTTAAAACTGGCTCTGCTGGGGAAATTAGAAAGC
AATGTGCATTTGTGAATAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGTGTTTGGGGTGTACTTCTTTGCTTTTTTAGCATATATGGGGTCAGCTGAAGCTCAACTCCAGATGGGTTTTTATTCTAAAAGCTGTCCAAGAGCTGAGCAAATTGTGCAAGGC
TTTGTTAACCAGCATATCCATAATGCTCCATCTCTTGCTGCTACTTTTATAAGAATGCATTTTCATGATTGTTTTGTCAGG
GGTTGTGATGCATCTGTGCTTTTGAATTCATCATCTTCA
GGCAATCAAACTGAAAAAAGTGCAACTCCAAATTTAACACTCAGAGGCTTTGGTTTTATTGACAGTGTTAAGAGCCTATTAGAAGCAGAGTGCCCCGGTGTTGTGTCTTGTGCTGATGTT
ATTGCTCTGGTTGCAAGAGATTCTATTGTGGCCACT
GGCGGTCCCTCCTGGAGAGTCCCAACAGGGCGAAGAGATGGAACTGTCTCAATGGCCTCAGAGGCCTTGAACAACATCCCACCT
CCAACTAGCAATTTGACTACTCTCCAAAGACTATTTGCTAATGTGGGACTGGACCTCAAAGACCTTGTCTTGCTATCCG
GTGCCCACACAATTGGAATAGCTCATTGCCCATCATTTTCG
AACCGCCTATACAATTTCACTGGAGTAGGGGATCAAGACCCAGCCCTAGACAGTGAATATGCAGCAGTTCTCAAGGCAAGAAAGTGCACAACTCCGAATGACAATACCACAATTGTTGAG
ATGGATCCTGGAAGTCGCAAAACATTTGATCTCAGCTACTACTCAAATTTACTAAAGAGAAGAGGACTTTTCCAATCAGATTCTGCTCTGACCACAAGCTCAGCTACATTGTCCACAATT
AACCAGCTGCTCAGTGGTTCACTTGAGAATTTCTTTGCTGAATTTGCTGCTTCAATTGAGAAAATGGGCCAAATTAATGTTAAAACTGGCTCTGCTGGGGAAATTAGAAAGCAATGTGCA
TTTGTGAATAGC

Retrieve as FASTA