Entry information : RcPrx76 (30190.m010916)
Entry ID 9398
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx76 (30190.m010916)
Name (synonym) RcPrx76 (30190.m010916)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx76
start..stop
S start..stop
MePrx64 567 0 1..330 1..324
PtPrx82 539 0 10..330 6..323
VvPrx65 533 0 1..330 1..323
PtPrx21 514 0 23..330 18..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 682526..682750 225 N° 2 681097..681288 192 N° 3 680366..680938 573  
complement(join(680366..680938,681097..681288,682526..682750))


exon

Literature and cross-references RcPrx76 (30190.m010916)
DNA ref. Phytozome 11:   30190 (682750..680366)
Protein sequence: RcPrx76 (30190.m010916)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (302)
PWM (Da):   %s   35576.56 (32383.0) Transmb domain:   %s   i7-24o
PI (pH):   %s   4.75 (4.60) Peptide Signal:   %s   cut: 29 range:29-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEARRDLLMMKMIMIMIIVSSMIGRGEGQLTENFYSSNCPNVEAIVKQVVSTKFRQTFTTIPATLRLFFHDCFVTGCDASIMISSPNGGAEKDAEDNLSLAGDGFDTVTKAKQAVEAQCPQVVSCADIIAIAARDVVVLAGGPSFSVELGRRDSLVSQASLVVGNLPEPDFTLSQLNDMFGKNNLSQIDMIALSGAHTLGFSHCNRFANRLYSFSPASPVDPTLDPNYAKQLMDACPQNVDPVIAVDMDPTTPRIFDNVYYQNLVAGKGLFTSDQVLFTDPSSKSTAIDFANSEGEFNGAFVTAMRKLGRVGIKTGNQGRIRTDCTNIDS

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCAAGGAGAGATTTGCTGATGATGAAAATGATAATGATAATGATAATAGTTTCTTCGATGATAGGTAGAGGAGAGGGGCAACTAACAGAGAATTTCTACAGCTCTAACTGTCCG
AATGTGGAAGCTATAGTGAAGCAGGTAGTGTCCACAAAGTTCAGGCAGACCTTCACTACAATCCCAGCCACTCTTCGTCTATTTTTCCATGATTGTTTTGTCACG
GTAATGATCAACAAT
ATTCATTTTATATACCAATTTAAGTTTATCTTTTCCTCGTTCATTTGCTGGTTTTGTTCACGCATGATGAATTTGCATGTTTCTATAATCCAGTGATGATTTATTTACTGTAGATAAAGT
AACGATTATGTTCGTTCCTCAGAAAAATCCATTTTCTTCTGGAGTTCTTATATCAAATAAGAATGATGACCATGTTACTCAATTAGCATTTGTTTGACATAGATGCTCCATTTGGTTGGG
TGACTTGTTATACAGACTCCAAAAACGATGAAAGATTAATTAGTGCGCTAGCTGAATTTGTTTTCAATTTTACCGTTTTGGATCAATACTTTCGGAGGTAAATTATGAATATATAAATTA
ACGTGGGGGTGTATTTTTAGACTCGAACAAATTAGTGGCTGAGTAAAAAATGTATATAAAGTTGATCTAAGCATCGTTAATTATTTAAAAAAGTAAATTAAGGCAGAAACTTTCCCTTTC
TTTTTATATATATATTTATTTGATCATACGTCGAGTATGACCCTTTCAAGAGGCCTGACACTTTTATTTCCTCTTACTACAAGTTATCCATATGTATTGTGGAAACAATTAAAACTGGTC
CACGCCTTTATTGTCTCAGCCCTCTATTCCCCGTGGCCGCAGACACATGGTCCTTTTTGGGTCGTTTGTTACAATTTGCTGTCTTCTCTGCAACCTATTTGCTTGGATTGTTATTGTAAT
AGGAAATTGATCAGAAGGGCTGAACCTGCACCTCTACCTGACGTAGATTACTTGTCCATCATTTTATTTTCTTTTCTTTCCGATGATTTTTAATTGAATTACCATTGCGTGTCTAATTAC
TCGATTAATCTAAAATGTTAATTTTGAAGTCAAATTCTTTTGTTCTACTTATGAAAGAACTGATTTAACTTTTCATCGGGGGCACCTAGCAATTTCAAAAACTATTTTTAACTTTACTGC
CAGAGAATGTCATAATAAAACTCAAACTCACCAGACGCCACAGTAGATTAATTTCAAAATTAAATTCTGACAGTAGTAAATGTTTCAATATCTGAAGTTATTTCTTATATGGGCAGAGTA
GTTGGTTGATTATACTCTTGTTTATTCATATTATTTGTGGACAGTTGCGTTCGCAATTTGAGAAGAAAAATAAGAAGAAAGAAAACAAGTAATTATAAGATTCGGTTTTCTAGTAATCTT
ATTTGCCTGTTCCTGATCATAGGGTTGTGATGCCTCGATTATGATTTCATCACCAAATGGAGGTGCGGAAAAAGATGCTGAGGATAATCTTTCCCTTGCAGGAGATGGATTTGACACCGT
AACGAAAGCAAAGCAAGCAGTAGAAGCACAATGCCCACAGGTGGTCTCTTGTGCAGATATTATAGCCATTGCTGCCAGGGATGTTGTAGTCCTG
GTAAGGAACCTACCATTAATTCTGTA
CAACTTAACAAAGTTGATGTAGATTCACGCCGCACTGTTTTTCTTTTACTTTTAGCTAGTATGAGCACAATTAAATAGCACCAAAATAACTTAACTGATCGTCATGCATGGTAATTATTA
AATGTTTTTCAGGCTGGAGGTCCTTCATTCAGTGTAGAATTGGGGCGTCGTGATAGCTTGGTATCTCAAGCATCACTTGTGGTAGGAAATTTACCAGAACCAGACTTCACGCTTTCGCAA
CTTAACGACATGTTTGGCAAAAACAACCTTAGCCAAATCGACATGATTGCACTTTCAGGAGCCCATACATTGGGATTCTCTCATTGCAATCGCTTTGCGAATCGCCTTTATTCGTTCTCT
CCAGCATCCCCTGTGGATCCTACTCTGGATCCAAACTATGCCAAGCAGCTGATGGATGCATGTCCTCAAAATGTAGACCCTGTTATAGCCGTAGACATGGACCCAACGACACCGCGAATC
TTTGACAATGTGTATTATCAAAATTTAGTTGCCGGAAAGGGTTTGTTTACTTCAGATCAGGTGCTGTTTACTGACCCTTCATCGAAGTCTACTGCCATTGATTTTGCAAATAGCGAAGGA
GAATTTAATGGAGCTTTTGTCACAGCCATGAGAAAGCTTGGTAGAGTAGGAATCAAGACTGGTAACCAAGGACGAATAAGAACGGACTGTACCAACATTGATTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCAAGGAGAGATTTGCTGATGATGAAAATGATAATGATAATGATAATAGTTTCTTCGATGATAGGTAGAGGAGAGGGGCAACTAACAGAGAATTTCTACAGCTCTAACTGTCCG
AATGTGGAAGCTATAGTGAAGCAGGTAGTGTCCACAAAGTTCAGGCAGACCTTCACTACAATCCCAGCCACTCTTCGTCTATTTTTCCATGATTGTTTTGTCACG
GGTTGTGATGCCTCG
ATTATGATTTCATCACCAAATGGAGGTGCGGAAAAAGATGCTGAGGATAATCTTTCCCTTGCAGGAGATGGATTTGACACCGTAACGAAAGCAAAGCAAGCAGTAGAAGCACAATGCCCA
CAGGTGGTCTCTTGTGCAGATATTATAGCCATTGCTGCCAGGGATGTTGTAGTCCTG
GCTGGAGGTCCTTCATTCAGTGTAGAATTGGGGCGTCGTGATAGCTTGGTATCTCAAGCATCA
CTTGTGGTAGGAAATTTACCAGAACCAGACTTCACGCTTTCGCAACTTAACGACATGTTTGGCAAAAACAACCTTAGCCAAATCGACATGATTGCACTTTCAGGAGCCCATACATTGGGA
TTCTCTCATTGCAATCGCTTTGCGAATCGCCTTTATTCGTTCTCTCCAGCATCCCCTGTGGATCCTACTCTGGATCCAAACTATGCCAAGCAGCTGATGGATGCATGTCCTCAAAATGTA
GACCCTGTTATAGCCGTAGACATGGACCCAACGACACCGCGAATCTTTGACAATGTGTATTATCAAAATTTAGTTGCCGGAAAGGGTTTGTTTACTTCAGATCAGGTGCTGTTTACTGAC
CCTTCATCGAAGTCTACTGCCATTGATTTTGCAAATAGCGAAGGAGAATTTAATGGAGCTTTTGTCACAGCCATGAGAAAGCTTGGTAGAGTAGGAATCAAGACTGGTAACCAAGGACGA
ATAAGAACGGACTGTACCAACATTGATTCT

Retrieve as FASTA