Entry information : AtPrx13 (At1g77100 / PER13 / AtperoxP13)
Entry ID 94
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx13 (At1g77100 / PER13 / AtperoxP13)
Name (synonym) AtPrx13 (At1g77100 / PER13 / AtperoxP13)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx13
start..stop
S start..stop
AlyPrx13 654 0 1..336 1..336
AhalPrx56 653 0 1..336 1..336
BstrPrx54 651 0 1..336 1..336
CagraPrx60 633 0 1..336 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28966809..28967066 258 N° 2 28966537..28966722 186 N° 3 28966267..28966432 166 N° 4 28965772..28966172 401
complement(join(28965772..28966172,28966267..28966432,28966537..28966722,2896680 9..28967066))


exon

Literature and cross-references AtPrx13 (At1g77100 / PER13 / AtperoxP13)
Protein ref. UniProtKB:   O49293
DNA ref. Phytozome 12:   Chr1 (28967066..28965772)
mRNA ref. GenBank:   NM_106360
Cluster/Prediction ref. Phytozome Gene 12:   19653648
Omic ref. AtProteome:   At1g77100 ATTED-II:   At1g77100 e-FP Browser:   At1g77100 ePlant:   At1g77100 Genevestigator:   At1g77100 TAIR:   At1g77100
Protein sequence: AtPrx13 (At1g77100 / PER13 / AtperoxP13)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336
PWM (Da):   %s   36742.63 Transmb domain:   %s   i13-35o
PI (pH):   %s   4.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRRIREDISIRLFDPKMITIALFLVLLYFHDQLGYSAAQLQFGFYSETCPSAESIVRDVVQQAVTNDPGKAAVLLRLQFHDCFVEGCDGSILIKHGGNDDERFAAGNAGVAGFDVIDEAKSELERFCPGVVSCADIVALAARDAIAEAKGPFYEVPTGRRDGLIANVDHAKNLPDVQDSINTLKSKFREKGLSDQDLVLLSAGAHTIGTTACFFVIPRLDAQDPTINPEFFQILRSKCPQGGDVNVRIPLDWDSQFVFDNQIFQNIKNGRGVILSDSVLYQDNNMKKIIDSYLETNQSSKANFAADFTKAMIKMGAIGVKIGAEGEIRRLCSATN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTTGTTTGT TTCTCGACGA CTAGCGAAGC TGTCTTTATC ATTCTATATC GTAATGTTAT GTCACCTCGT CTCTTTACGT TACCACCAAA GTATACACAC GCATATACAT ATGAAAACAC  TATGGTTTAA ACATTATTAA CGAGGTCTTC ACTAATATTT TGGAAATATT TATCTAAAAA AGAACAAAAA ACTGAGGAAA AAGATGGAAA AAAGAAGGTA TGATGATGAG AATGAAGACT  AAGAGGAAGC GCATGGGATC GAGGAAAGGG GAAAAAATAT GAATAGAAGT GAGATTATTG GTAGGTTAGA AAATCAAATC AAATTCAAGT GCGAAAAATG ATGGTTTCAT TTCAAAATTC  TATATTACAC ACTATAAATT TTAGGATTTT TTTTAAAAAG GGAAAAATTG GAAAGTGAGT GAGAAAATGG TCTGAGAAAA GGGGGCAAGA ACTAAAAATG TGTCTGGTCT AGTCATTGGA  GAGATAGAGA GGTTGGAGTG TGAATATCAA AGGAAAGTGA CATAACATAA GTGTTTGCAT CTTTCTAACT CCCTTCTCTT CGCGTGCCAT CAATTCATCA TTTTGTTCGT TTCTTATTTT  TTGTTCTACT TTACCTCATT TCCCCTCAAC TTCTTTCTGT ATTTTTCGTT ACAAACATGG TTACATTATT CCGTCTTGTC AATGTACATG TGCATATGAT AGATATATAG ATACGTCATA  CGTAGAAGTA TCAGGTCTTT TGTTGTTGCA ATGCTATTTG AAAAATAGTT TCTAAGTTTT CTTGATCCAC TTAACTTAAG CATATACTTC AAATCTGCAT GAAACATTAT GTCTTTTGCG  TTTTTTAAGT ATTACGATCT TCATTATCTT AAACGGGTCT TTTTATTGTG TATAGACAAC TGGAGTATTA TTCTAAATCC AGTTCCTAAA TTCAGGTTTA AGCCCTTTGC AAGGAAATAT  TTGCTGGGCC CAATCTTTCA AAAGATCTCC ATCAATTGTT TTGTTACAGG TAGAATATAA CATATATACA TTGTAACAAA TAAATATTTT GTTCAAAAAT CTAACCAATT TTGGATAATA  CTTAGATATA GAATTTTTCT GACTATATTA ACGCATTTAG AAGAGAAACC GTAACATTAG CTTTTTATTT TTTTGGGCTA AATCCGTAAA CATTAGCTAA TTGCCTAAAT CTCAGTCTCA  CTCCTCTGTT TTGTATAAAA CATTTTAAGA AATAATACGA TACCGAGATA CCGAGATTAC AGATATACCC CTGGGCTGTT ATAACGAACA AACCGATTTA ACACGTGCTC CTCACGTGAA  AAAGAGCTAA GTAGCTAAGT CCTAATTACT TTTGTTTACT GAAACCTTCT GTCTCAGTGG GATTCTTCCA CATTCACCGA ACGTACCTCC TCAAGTTTGT TGCCATTTGC AGTCATTTGG  TTGTGTTGTT GTGATACTCA CTTTGACATT TTGCAGAGAA AACAAAAGAC GTTACGAAGG ATTTCAATAT ATATCTCTTT AAGTTGTTGC CACATGCAGT TTACTTAACT TTAATATTCG  CCACGTTACT ATAGATTGAT TATACATACC TTTTGACGAG ATAGGCCTAT ATTTAGCGTT TTTTTCTTTC TTAATTATTG ATTAATTGGC AAAACGTAGA TTTTGTTTGT TTTTGAAATA  AGTAGATTTA TCATTCATTC TCATAGCTTC TGGTGGAATA AGAACTCAAT TATTTGAAAA TATAAAATGG AAGAAATTTA CTTCATTGAA TATTATTTTT TGTGTTTTTG TTTTATATGT  ACAAGAATCC TTTTGACAAA AATTAACAGA TGGGATTGTC ACCTTTCGGA TGATTTTACG CGGTAACAGC TATATGCAAT AAATGACATA AGGTCAAAAA TATGAAGGAC ATATACACCT 
CCTCTATATG CATAATTGCA TATAAATATA ATCCGAGCAT ATATAAAAAC TTTGCAACTT ATCTTAAACA ATCATCAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTCCAAGAT CTCATACATA GTTAAGTATA ACAATTTGAG TTTGTTGGTT TAACAAAATA AACAAATTTG AATTATGAAA AGATATATTT ATACCAATTA TTGTAGCATT GCATATACGT  CTATTAATCT ATTAGATATT CAATCCCACC ATATTGGAAT CGGAAAATAA AAAAGATTTG AATAAATCCT AGTTTGTTTC TTATCAAGAT GTTTCCAAAT AAAAATATAG TGATTTTTCA  AATATTTCTG TAAATAGAAA GTTATTATAT AAGTATTTGT TATCAAAATT AATGGTCACA CACAATTCTT TGTAAGCTGG ATCAACAAAA TGATGATATT GTGCTAACTT CAAAGGTAGG  TTGCTTTGGT TAGACATGTC AACTTAAGGT AAAATCTATG CAAAACATAA GCAAAATATA AGCAAAATAT AAGCAAAAAT TGTGGAAATG TTATTCAGTT TCACGGGCTT GCTCCACTGT  CTTACTTTCC AAATTACCTC AGTAGGTTCT TAGCCGGCGT TGGAGGCTTC AACATTATAG GCAAGGTAAA ATCTGCCGTT GAGCGGTCTT GCCCCGATGT TGTGTCGTGT GCGGACATCA  TCGCTATAGC TGCCAGAGAC GCCATTATAA CAGTAATATA CCCCACAAAT ATAATTTTAA AAAATGCTCA ATGTTCTTTA TTATACGTAC ATTGACGGGT TATCTAACAT CAAATTTGTA  TACAATAGGC GAAAGGATCC TTCTACGAGG TTCCGACAGG CCGAAACGAT GGTCGGATCT CGAATGTAAA AAACGCTGAG AAGTTGCCAG ACGCTCAAGA CTCTATCGCA ACTTTGAAAG  CAAAGTTCAG AGAGCAAGGT CTTACAAACC GAGACCTTGT GCTTCTTAGC AGGTTAATGT AAAAACAAAA TCCTTTTATT TAATTAGGAT ATATAACTTT CTCGTTACTA AAAATTGAAT 
ATTTGTTTCT GGTAAAGGTG CGCATACCAC CGGATCGACG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCGTAGAATACGAGAAGATATATCAATTCGTTTGTTTGATCCCAAAATGATCACTATTGCATTATTTCTAGTTTTGTTATATTTTCATGATCAATTAGGTTATTCAGCGGCACAA
CTTCAGTTTGGATTCTACTCGGAAACATGTCCATCAGCAGAGTCAATCGTTCGTGATGTTGTTCAACAGGCGGTGACCAACGACCCAGGGAAGGCTGCTGTCTTACTCCGTCTCCAGTTC
CACGATTGCTTTGTCGAG
GTCCAATGCAAAGCAAAAAAAACGAAGTAAAATCTCTTTTTTTATAACTAGCTAGTGACATAAATTGGTTTGGTTGTATGTTGTAGGGTTGTGATGGGTCAA
TACTAATCAAGCATGGTGGGAACGATGACGAAAGGTTTGCTGCGGGTAACGCGGGGGTGGCTGGTTTCGATGTTATAGACGAAGCCAAATCAGAGCTTGAACGTTTTTGTCCGGGCGTTG
TGTCTTGCGCTGACATCGTTGCTCTTGCTGCTAGAGACGCTATTGCTGAG
GTAACACTTTAATACTTCTTTATAGAACTTTTTTTTTAATACACGTACGATGTATATGTGTTGGGTTAAA
TAAGATCCTTTGATATTAAATATTAACTTATTAGGCAAAAGGACCATTTTATGAAGTTCCAACCGGTCGGAGAGACGGTCTGATTGCAAATGTTGATCATGCTAAGAACTTGCCAGATGT
TCAAGATTCCATAAATACTTTGAAATCAAAATTTAGAGAAAAAGGGCTTTCAGATCAAGATCTTGTACTTCTTAGTGCTG
GTATTTATCATAATCTCAACAACTTGATTAAATACTATTT
TGAAAAGACAAAAAAAACACTATCTTGCTTACTCGAATTTTATTTTTGTTAAAGGTGCACATACTATTGGTACAACGGCTTGCTTCTTTGTCATACCACGTTTAGATGCTCAAGATCCTA
CGATAAACCCGGAATTTTTTCAAATCCTGAGGTCAAAGTGTCCCCAAGGCGGTGATGTTAATGTCAGGATTCCGTTGGACTGGGATAGCCAATTTGTGTTTGATAACCAAATCTTCCAAA
ACATCAAAAATGGCAGAGGTGTCATTCTATCGGACTCTGTTTTATACCAAGACAATAATATGAAGAAAATCATTGATTCATACTTAGAAACTAATCAAAGTTCAAAGGCTAATTTTGCTG
CGGATTTCACTAAAGCCATGATAAAGATGGGTGCTATCGGAGTGAAAATCGGTGCTGAAGGAGAGATTAGACGTTTATGCAGTGCTACAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCGTAGAATACGAGAAGATATATCAATTCGTTTGTTTGATCCCAAAATGATCACTATTGCATTATTTCTAGTTTTGTTATATTTTCATGATCAATTAGGTTATTCAGCGGCACAA
CTTCAGTTTGGATTCTACTCGGAAACATGTCCATCAGCAGAGTCAATCGTTCGTGATGTTGTTCAACAGGCGGTGACCAACGACCCAGGGAAGGCTGCTGTCTTACTCCGTCTCCAGTTC
CACGATTGCTTTGTCGAG
GGTTGTGATGGGTCAATACTAATCAAGCATGGTGGGAACGATGACGAAAGGTTTGCTGCGGGTAACGCGGGGGTGGCTGGTTTCGATGTTATAGACGAAGCC
AAATCAGAGCTTGAACGTTTTTGTCCGGGCGTTGTGTCTTGCGCTGACATCGTTGCTCTTGCTGCTAGAGACGCTATTGCTGAG
GCAAAAGGACCATTTTATGAAGTTCCAACCGGTCGG
AGAGACGGTCTGATTGCAAATGTTGATCATGCTAAGAACTTGCCAGATGTTCAAGATTCCATAAATACTTTGAAATCAAAATTTAGAGAAAAAGGGCTTTCAGATCAAGATCTTGTACTT
CTTAGTGCTG
GTGCACATACTATTGGTACAACGGCTTGCTTCTTTGTCATACCACGTTTAGATGCTCAAGATCCTACGATAAACCCGGAATTTTTTCAAATCCTGAGGTCAAAGTGTCCC
CAAGGCGGTGATGTTAATGTCAGGATTCCGTTGGACTGGGATAGCCAATTTGTGTTTGATAACCAAATCTTCCAAAACATCAAAAATGGCAGAGGTGTCATTCTATCGGACTCTGTTTTA
TACCAAGACAATAATATGAAGAAAATCATTGATTCATACTTAGAAACTAATCAAAGTTCAAAGGCTAATTTTGCTGCGGATTTCACTAAAGCCATGATAAAGATGGGTGCTATCGGAGTG
AAAATCGGTGCTGAAGGAGAGATTAGACGTTTATGCAGTGCTACAAACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCGTA GAATACGAGA AGATATATCA ATTCGTTTGT TTGATCCCAA AATGATCACT ATTGCATTAT TTCTAGTTTT GTTATATTTT CATGATCAAT TAGGTTATTC AGCGGCACAA  CTTCAGTTTG GATTCTACTC GGAAACATGT CCATCAGCAG AGTCAATCGT TCGTGATGTT GTTCAACAGG CGGTGACCAA CGACCCAGGG AAGGCTGCTG TCTTACTCCG TCTCCAGTTC  CACGATTGCT TTGTCGAGGG TTGTGATGGG TCAATACTAA TCAAGCATGG TGGGAACGAT GACGAAAGGT TTGCTGCGGG TAACGCGGGG GTGGCTGGTT TCGATGTTAT AGACGAAGCC  AAATCAGAGC TTGAACGTTT TTGTCCGGGC GTTGTGTCTT GCGCTGACAT CGTTGCTCTT GCTGCTAGAG ACGCTATTGC TGAGGCAAAA GGACCATTTT ATGAAGTTCC AACCGGTCGG  AGAGACGGTC TGATTGCAAA TGTTGATCAT GCTAAGAACT TGCCAGATGT TCAAGATTCC ATAAATACTT TGAAATCAAA ATTTAGAGAA AAAGGGCTTT CAGATCAAGA TCTTGTACTT  CTTAGTGCTG GTGCACATAC TATTGGTACA ACGGCTTGCT TCTTTGTCAT ACCACGTTTA GATGCTCAAG ATCCTACGAT AAACCCGGAA TTTTTTCAAA TCCTGAGGTC AAAGTGTCCC  CAAGGCGGTG ATGTTAATGT CAGGATTCCG TTGGACTGGG ATAGCCAATT TGTGTTTGAT AACCAAATCT TCCAAAACAT CAAAAATGGC AGAGGTGTCA TTCTATCGGA CTCTGTTTTA  TACCAAGACA ATAATATGAA GAAAATCATT GATTCATACT TAGAAACTAA TCAAAGTTCA AAGGCTAATT TTGCTGCGGA TTTCACTAAA GCCATGATAA AGATGGGTGC TATCGGAGTG 
AAAATCGGTG CTGAAGGAGA GATTAGACGT TTATGCAGTG CTACAAACTA G 

Retrieve as FASTA