Entry information : RcPrx[P]81 (30190.m011147)
Entry ID 9409
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-12-02 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: RcPrx[P]81 (30190.m011147)
Name (synonym) RcPrx[P]81 (30190.m011147)
Class Class III peroxidase     [Orthogroup: Prx014]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx[P]81
start..stop
S start..stop
RcPrx77 281 3e-94 12..297 25..314
MePrx109 249 6e-82 11..297 24..312
PtPrx24 246 8e-81 3..297 15..313
PtPrx23 244 8e-80 3..297 15..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2179809..2179910 102 N° 2 2179941..2180045 105 N° 3 2180130..2180599 470 N° 4 2180620..2180856 237
join(2179809..2179910,2179941..2180045,2180130..2180599,2180620..2180856)


exon

Literature and cross-references RcPrx[P]81 (30190.m011147)
DNA ref. Phytozome 12:   30190 (2179809..2180856)
Protein sequence: RcPrx[P]81 (30190.m011147)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   309
PWM (Da):   %s   34326.29  
PI (pH):   %s   7.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTYHLSSICICQAQLSSNFYVNRCPNSLSTFTHRIGSISGSRLHFAIALFRYILISLFIHKFSSHFIFSSMTGEKFARSNNDSVRGFQVIDNAKAQVESICPGIVSCADIDAVAARDASIAVSDDVLALPLFILFKLLAIDGVCIN*LYESLISFFIQFLWIILHILSDG*RVVPDTGVHTIGQARCLTFRDRIYNNASDIDAGFAITQRRHCPANNGNEGGNPAGLALVTPNFFDYPYFRNLIQKRVFFNQFNF*GVDLQHIVNEHSRGPSSFSSDFASTMEKMGDIEPLTGFQAKWESSAMLRTDLLIEF

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Stops in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTACCATTTATCTTCTATTTGCATATGCCAAGCGCAGCTTTCATCAAATTTCTATGTCAACAGATGTCCTAATTCATTGAGTACTTTTACGCACCGCCACTAGCACTGCCGTTTT
GCGTGAGCGGAGATTGGCAGCATCTCTGGTTCGCGCCTCCATTTCGCGATTGCTTTGTTCAGGTATATATTAATTTCTTTATTTATTCATAAATTTAGTAGTCACTTTATTTTCTCAAGA
ACTTGAACTGAAATCCTGGAGAGTATTATTACTTGCATTTAAGGGTTGTGATGGTTCAATCTTGCTGGAGGATATACATCTTCAATGACTGGCGAAAAATTTGCACGCAGCAACAATGAT
TCGGTTAGAGGATTCCAAGTTATAGATAATGCNAAAGCGCAAGTCGAAAGCATATGTCCTGGAATTGTTTCTTGTGCTGATATTGATGCAGTTGCAGCTAGGGATGCATCTATTGCTGTA
AGTGATGACGTTCTTGCGCTTCCTTTGTTTATTTTATTCAAACTTCTTGCAATTGATGGTGTTTGTATTAATTAACTGTACGAAAGTTTAATTAGTTTCTTCATTCAATTTTTGTGGATT
ATACTACATATATTATCGGATGGCTAAAGAGTTGTTCCGGATACAGGAGTACATACAATAGGGCAAGCAAGATGCCTGACCTTCCGTGATAGGATTTACAACAATGCAAGCGATATTGAT
GCTGGCTTCGCAATCACCCAAAGACGCCACTGTCCTGCTAACAATGGCAACGAAGGTGGAAATCCAGCAGG
ACTTGCTTTGGTTACACCTAATTTTTTTGATATAACTACTTCAGGAATC
TTATTCAGAAAAGGGTCTTCTTCAATCAGTTCAACTTCTGAGGGGTGGATCTACAGCACATTGTTAATGAACATAGCAGGGGCCCTTCAAGTTTCAGTTCTGATTTCGCTTCTACAATGG
AAAAGATGGGAGATATAGAGCCCCTAACTGGTTTTCAAGCAAAATGGGAAAGCTCTGCAATGTTGCGAACTGATTTGTTGATTGAATT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTACCATTTATCTTCTATTTGCATATGCCAAGCGCAGCTTTCATCAAATTTCTATGTCAACAGATGTCCTAATTCATTGAGTACTTTTACGCACCGCATTGGCAGCATCTCTGGT
TCGCGCCTCCATTTCGCGATTGCTTTGTTCAGGTATATATTAATTTCTTTATTTATTCATAAATTTAGTAGTCACTTTATTTTCTCA
TCAATGACTGGCGAAAAATTTGCACGCAGCAAC
AATGATTCGGTTAGAGGATTCCAAGTTATAGATAATGCNAAAGCGCAAGTCGAAAGCATATGTCCTGGAATTGTTTCTTGTGCTGATATTGATGCAGTTGCAGCTAGGGATGCATCTATT
GCTGTAAGTGATGACGTTCTTGCGCTTCCTTTGTTTATTTTATTCAAACTTCTTGCAATTGATGGTGTTTGTATTAATTAACTGTACGAAAGTTTAATTAGTTTCTTCATTCAATTTTTG
TGGATTATACTACATATATTATCGGATGGCTAAAGAGTTGTTCCGGATACAGGAGTACATACAATAGGGCAAGCAAGATGCCTGACCTTCCGTGATAGGATTTACAACAATGCAAGCGAT
ATTGATGCTGGCTTCGCAATCACCCAAAGACGCCACTGTCCTGCTAACAATGGCAACGAAGGTGGAAATCCAGCAGG
ATTTTTTTGATATAACTACTTCAGGAATCTTATTCAGAAAAGG
GTCTTCTTCAATCAGTTCAACTTCTGAGGGGTGGATCTACAGCACATTGTTAATGAACATAGCAGGGGCCCTTCAAGTTTCAGTTCTGATTTCGCTTCTACAATGGAAAAGATGGGAGAT
ATAGAGCCCCTAACTGGTTTTCAAGCAAAATGGGAAAGCTCTGCAATGTTGCGAACTGATTTGTTGATTGAATT

Retrieve as FASTA