Entry information : VvAPx04 (GSVIVT01018740001)
Entry ID 9410
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: VvAPx04 (GSVIVT01018740001)
Name (synonym) VvAPx04 (GSVIVT01018740001)
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Vitaceae Vitis
Organism Vitis vinifera (Grape)    [TaxId: 29760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VvAPx04
start..stop
S start..stop
CroAPx03 392 9e-139 19..298 5..284
PtAPx05 389 1e-137 20..298 5..281
LeAPx06 382 1e-134 21..298 6..281
HaAPx06 380 8e-134 20..298 7..282
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20283545..20283702 158 N° 2 20282994..20283118 125 N° 3 20282724..20282773 50 N° 4 20282512..20282577 66
N° 5 20282386..20282434 49 N° 6 20282024..20282106 83 N° 7 20281852..20281931 80 N° 8 20281727..20281750 24
N° 9 20281564..20281642 79 N° 10 20281250..20281459 210  
complement(join(20281250..20281459,20281564..20281642,20281727..20281750,2028185 2..20281931,20282024..20282106,20282386..20282434,20282512..20282577,20282724..2 0282773,20282994..20283118,20283545..20283702))


exon

Literature and cross-references VvAPx04 (GSVIVT01018740001)
DNA ref. Phytozome 11:   chr4 (20283702..20281250)
Protein sequence: VvAPx04 (GSVIVT01018740001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   308
PWM (Da):   %s   33983.31 Transmb domain:   %s   o281-298i
PI (pH):   %s   9.17
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEVQASTSASAPAPTPAPLVVNAEYYKEIERARRYLRALISSKNCAPMMLRLAFHDAGTYDALTKTGGPNGSIRNPQELNHSANRGLETAVDLCEKVKRKHPCITYADLYQLAGVVAVEVTGGPTIHFVPGRQDSLSSPKEGLLPDANKGADHLRSVFNRMGLEDKDIVALSGGHTLGGAHKQVSGFDGKWTEEPWKFDNSYFKELLKSSTKRLFIFSTDQALIKDPKFLEYVMLYEQDEEAFFRDYAASHKKLSELGFVPPTWTSRVITAVKNSSTMAKTAAGVAFATTAIAITFYYRQRSQRKEE*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Extra 5' end has been removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGTCCAAGCCTCAACCTCAGCCTCTGCACCAGCACCAACTCCAGCACCACTAGTTGTAAATGCAGAATACTACAAAGAAATCGAAAGGGCTCGTAGATACCTCCGTGCTCTCATT
TCCAGCAAAAACTGTGCACCCATGATGCTCCGTCTAGC
GTAGTGTCCCTTAAGTTTAATTTATGCTTCTTTTTCATTTTCCCTGCATTTCATTTCATTTAGTAAATGTTAGAACTGACAT
TTCGAAGGGAGGGGAGAAAACATAAGTGGTTGCATTTCAATAGACGGGGAAGATAAGATGAAAATTTCAGAAAAATTAGGAAAAAAAAGAAAAAGGCTTTTCTAGGTGTTATGACTTATG
GCGTGTCAGAAATACGGCCATGAACAGGCCATGAACAAAACGATTCATACATGTGTGTGTGTTTTTTGCAAGGTTCAAATTAACGGAGACTTAGTATTTGGCATGTATGGGGGGGAGGAT
CGTGAGCTGATTTTTTGCATTCTGGCTCTATTGGATTTTAAAGTAATTTAGCTTTAATGCATGAGGGTTTAATGATCGGAAGCTAAATAGCATTTTGTTTGCAGGTTTCATGATGCAGGC
ACTTATGATGCTCTCACAAAGACAGGGGGCCCAAATGGCTCCATCAGAAACCCACAAGAGCTTAATCATTCTGCAAATAGGGGTTTGGAAACGGCAGTTGATCTTTGCG
GTGAGATTCAT
TTTCCCTTTTGCCCTTGCACACTGGCAAAAGATTTGTCCCTCCCCTTTTTTTTTTTTTGCTTGTATTGTAATCAGACTCCTTTTAATGAGGTTCAGTGCCGAGATAGTATGATTGGGACT
TCATCCCACCACAACTCTCAGTTTTTCCTACTTGAAATTGAAATACTATTTTTTTCTTCTAATGGGCTCTGGTTCTGCTCTGATGTCAGAGAAGGTGAAAAGGAAGCATCCTTGCATTAC
ATATGCTGACCTTTACCAG
GTGACTCTTGTTTCAGAAATTAACTGTTCTGTGATTTAATTTGAATTCATTGAGAAGCTAAGGATAAAAACAAGCTCTGGTTTGCATCATCTTTGCAAGTG
GATGCCGGTGTGGTCGCTTTCCTGACTCCTTTGGGGTTTTGTCAGCTTGCTGGTGTTGTTGCAGTTGAGGTTACTGGAGGCCCCACTATTCACTTCGTCCCTGGTAGACAGGTTGGTTCA
TGGAGGAAGCTTTTGATCACCTTTCTCAAATATTACTCCTAATTTTTTCCCCCCTGTTTTTCAACCAGGACTCTTTGTCTTCACCAAAAGAAGGGCTCCTCCCAGATGCTAACAAAGGTT
CCCATTCTGTTTTCTTTATGCTCTCTGGCCTTGTTTATGGAAAAGAAGTCATTTTCCTATTCTGCTCTATAACTCACAGATAATGCATAGAGACTTGAACCTTATCGTTTGTCGAATTCT
GTCATTTCACCCCTTGGTCCCCTCTCTAGCTTTTCAGCTGTGCTCCTTCTACAAATTGTTTCTTGGTTGTTATGCATCAGAAATCAGAGCTCTCTTATACTTCCCATATAAGACCAAGCA
GAAAATTTACATTACTCTTATTAAATTTTGTTGCAGGTGCTGACCATTTAAGGTCGGTCTTTAACCGGATGGGTCTTGAGGACAAGGATATTGTGGCCCTCTCCGGAGGTCATACATTGG
TAACTTCCTCCACAGATCTGCAGCTATCTTTAAAAAGTTCTTTCAGCATCCACAAATATGCATGTAGTTTTTGTTTGGTTTGGTGTTGTAGGGAGGGGCACATAAGCAAGTTTCAGGCTT
TGATGGCAAGTGGACAGAGGAGCCCTGGAAGTTCGACAATTCGTATTTCAA
GTAAGGTTTCATTTGAGAATTCATTGATTGGAACGCATATAAATGCAGCAATGTTTCAATTATATATGA
TGGCTATATGTTATGATTAATATTGTAATCAGGGAGCTTTTGAAATCATCAACCAAGTTTCCTACACCTAGTAACCCTCCAACAGGGTATTCACAGCAGAAACCTTCTTCTTCAGCTGCG
GGCGAGGATTCAACAGGGAGGCGATTGTTTATATTTTCCACAGACCAAGCATTAATAAAGGATCCTAAATTCCTAGAATATGTTATGTTGTATGAACAGGTAATGTAGTATTTTGCTGGA
ACCTTCGTGGATGTTCACATAGTCTCATGCAGTCTCTTGTAACCCTTTACTGTTTTTCTTATCATATTTCTGGTACATGGCAGGATGAGGAGGCTTTCTTCAGAGATTATGCGGCATCCC
ACAAGAAGCTTTCGGAGCTAGGGTTTGTTCCACCTACATGGACTTCCAGGGTAATCACAGCTGTGAAGAACAGTTCAACCATGGCAAAAACTGCTGCAGGAGTTGCTTTTGCGACAACTG
CTATAGCCATTACTTTCTACTATAGACAAAGAAGTCAAAGGAAAGAGGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGTCCAAGCCTCAACCTCAGCCTCTGCACCAGCACCAACTCCAGCACCACTAGTTGTAAATGCAGAATACTACAAAGAAATCGAAAGGGCTCGTAGATACCTCCGTGCTCTCATT
TCCAGCAAAAACTGTGCACCCATGATGCTCCGTCTAGC
GTTTCATGATGCAGGCACTTATGATGCTCTCACAAAGACAGGGGGCCCAAATGGCTCCATCAGAAACCCACAAGAGCTTAAT
CATTCTGCAAATAGGGGTTTGGAAACGGCAGTTGATCTTTGCG
AGAAGGTGAAAAGGAAGCATCCTTGCATTACATATGCTGACCTTTACCAGCTTGCTGGTGTTGTTGCAGTTGAGGTT
ACTGGAGGCCCCACTATTCACTTCGTCCCTGGTAGACAG
GACTCTTTGTCTTCACCAAAAGAAGGGCTCCTCCCAGATGCTAACAAAGGTGCTGACCATTTAAGGTCGGTCTTTAACCGG
ATGGGTCTTGAGGACAAGGATATTGTGGCCCTCTCCGGAGGTCATACATTG
GGAGGGGCACATAAGCAAGTTTCAGGCTTTGATGGCAAGTGGACAGAGGAGCCCTGGAAGTTCGACAAT
TCGTATTTCAA
GGAGCTTTTGAAATCATCAACCAAGCGATTGTTTATATTTTCCACAGACCAAGCATTAATAAAGGATCCTAAATTCCTAGAATATGTTATGTTGTATGAACAGGATGAG
GAGGCTTTCTTCAGAGATTATGCGGCATCCCACAAGAAGCTTTCGGAGCTAGGGTTTGTTCCACCTACATGGACTTCCAGGGTAATCACAGCTGTGAAGAACAGTTCAACCATGGCAAAA
ACTGCTGCAGGAGTTGCTTTTGCGACAACTGCTATAGCCATTACTTTCTACTATAGACAAAGAAGTCAAAGGAAAGAGGAGTAA

Retrieve as FASTA