Entry information : VvPrx91 (GSVIVT01010261001)
Entry ID 9422
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: VvPrx91 (GSVIVT01010261001)
Name (synonym) VvPrx91 (GSVIVT01010261001)
Class Class III peroxidase     [Orthogroup: Prx014]*
Taxonomy Eukaryota Viridiplantae Streptophyta Vitaceae Vitis
Organism Vitis vinifera (Grape)    [TaxId: 29760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VvPrx91
start..stop
S start..stop
VvPrx10 299 4e-104 3..176 53..226
VvPrx51 290 3e-100 3..176 53..226
VvPrx32 287 4e-99 3..176 53..226
VvPrx45 286 2e-98 3..176 82..255
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18557872..18557877 6 N° 2 18557964..18558155 192 N° 3 18558267..18558432 166 N° 4 18558510..18558676 167
join(18557872..18557877,18557964..18558155,18558267..18558432,18558510..18558676 )


exon

Literature and cross-references VvPrx91 (GSVIVT01010261001)
DNA ref. Phytozome 12:   chr1 (18557872..18558676)
Protein sequence: VvPrx91 (GSVIVT01010261001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   176
PWM (Da):   %s   18482.01  
PI (pH):   %s   6.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIGCDASILLDDSSSIQSEKNTPNNLNSVRGYEVIDHVKSQVESNCPGIVSCADILAVAARDASVAVGGSTWTVKLGRRDSATSGLSQASNNLHNLRDSLGRLISLFGSKGLSTRYMVALSGSHTIGQARCVTFQDRIYYNGTNIDASFASTRRCCCPSNNGDGDDNLAALDLVTP

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Both 5' end and 3' end are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTGCTTTGTTCAGGTATTCATTCCTTTCTGTCCAGCTATACTAGTTGTCCTTGTAAGATTTTTTTAAGTCATTGGATTAATACTGCAGGGATGTGATGCATCAATCTTGCTTGATG
ATTCCTCCTCCATTCAAAGTGAGAAAAATACACCTAATAATTTGAATTCAGTTAGAGGATATGAAGTCATAGACCACGTAAAGTCTCAAGTGGAGAGCAACTGTCCCGGCATTGTATCTT
GTGCTGACATTCTTGCAGTGGCAGCCCGAGATGCATCCGTTGCT
GTAAGTATACCTTTAATGTTATTACCGTAAGCATGATCATGTCTCTTGATTGTTTTTTATGTATTGATTCCATAAT
GATATTGTCAATTTTTTTATGTATACATGAAATAGGTTGGAGGGTCAACATGGACAGTGAAGCTTGGAAGAAGAGACTCCGCCACTTCAGGCCTCAGCCAAGCTTCCAACAACCTTCATA
ATTTGAGAGATAGCCTTGGTAGGCTTATTTCCTTGTTTGGTAGCAAAGGTTTGAGTACAAGATACATGGTTGCCCTTTCAG
GTAGGTGGAATAAATTTGAATTCACTTTTGGTCATGTAT
ACGACTTAATACAAATTAATTCACTGAATGGAATACAGGTTCCCACACAATAGGCCAAGCAAGATGTGTGACATTCCAGGATAGGATATACTACAATGGAACTAATATTGACGCCAGCTT
TGCTAGTACCAGAAGATGCTGTTGTCCTTCTAATAATGGGGATGGTGATGACAATCTTGCAGCCCTAGATTTGGTTACACCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTGGATGTGATGCATCAATCTTGCTTGATGATTCCTCCTCCATTCAAAGTGAGAAAAATACACCTAATAATTTGAATTCAGTTAGAGGATATGAAGTCATAGACCACGTAAAGTCT
CAAGTGGAGAGCAACTGTCCCGGCATTGTATCTTGTGCTGACATTCTTGCAGTGGCAGCCCGAGATGCATCCGTTGCT
GTTGGAGGGTCAACATGGACAGTGAAGCTTGGAAGAAGAGAC
TCCGCCACTTCAGGCCTCAGCCAAGCTTCCAACAACCTTCATAATTTGAGAGATAGCCTTGGTAGGCTTATTTCCTTGTTTGGTAGCAAAGGTTTGAGTACAAGATACATGGTTGCCCTT
TCAG
GTTCCCACACAATAGGCCAAGCAAGATGTGTGACATTCCAGGATAGGATATACTACAATGGAACTAATATTGACGCCAGCTTTGCTAGTACCAGAAGATGCTGTTGTCCTTCTAAT
AATGGGGATGGTGATGACAATCTTGCAGCCCTAGATTTGGTTACACCCTGA

Retrieve as FASTA