Entry information : SiPrx02 (Si001945m)
Entry ID 9436
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: SiPrx02 (Si001945m)
Name (synonym) SiPrx02 (Si001945m)
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx02
start..stop
S start..stop
SbPrx66 604 0 1..365 1..369
ZmPrx137 578 0 1..365 1..371
BdiPrx92 567 0 1..363 1..367
HvPrx25 513 0 1..347 3..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32553096..32553395 300 N° 2 32553492..32553707 216 N° 3 32555157..32555741 585  
join(32553096..32553395,32553492..32553707,32555157..32555741)


exon

Literature and cross-references SiPrx02 (Si001945m)
DNA ref. Phytozome 12:   scaffold_5 (32553096..32555741)
Protein sequence: SiPrx02 (Si001945m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366 (335)
PWM (Da):   %s   38207.87 (34794.9) Transmb domain:   %s   i13-31o
PI (pH):   %s   10.21 (9.70) Peptide Signal:   %s   cut: 32 range:32-366
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDSSRGTRIRRRVTLFLLLLVASSLVGTSRAREAQPLPTAAAGGGSRRAPERHGLSLDFYAKTCPAVDQIVASVTAARYKDFPAAGPAVLRLFHHDCFVEGCDASILxxxxxxxxxxSAAPTVERDMEENKNLPQEAFDTVELAKAAVESKCPGVVSCADVLALAARDYVQQAGGPYYPVKKGRKDSKVSLAGKVRGSLPRSNSTVDELLRVFAGKGLGTADLVALSGAHTVGFAHCVHVLGRIYDFRGTRRPDPLMDARLVKALRMSCPSSGGSARVVVPFDVSTPFQFDHAYYANLQARLGLLGSDQALSQDPRTRAMAQELAGNKTRFFQAFVASMDRMGSIRIKKGRKGEIRKVCSQHLLAV

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Undetermined residues due to NNNN in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATTCCTCTCGAGGCACCCGCATCCGCCGTCGCGTCACCTTGTTCCTCCTGCTGCTCGTCGCGTCGTCCCTCGTCGGGACGTCGCGCGCCAGGGAGGCGCAGCCGCTGCCGACCGCG
GCGGCCGGCGGTGGGAGCAGGCGGGCGCCGGAGCGGCACGGGCTGTCGCTGGACTTCTACGCCAAGACGTGCCCCGCGGTCGACCAGATCGTCGCCAGCGTCACCGCCGCACGGTACAAG
GACTTCCCCGCCGCCGGACCCGCCGTGCTCCGCCTCTTCCACCACGACTGCTTCGTCGAA
GTACGTTGTAAATCCTTGAGTAATACAAGCTCGCATTGTGTGTAATTATATATAGTTATC
ATTGATTCTGATGTGAATTGCACGCGCTTGACGCAGGGCTGCGACGCGTCCATCCTGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTGCGGCGCCCACGGTGGAGCGCGACATGGAG
GAGAACAAGAACCTGCCGCAGGAGGCGTTCGACACAGTGGAGCTGGCCAAGGCCGCCGTGGAGAGCAAGTGCCCCGGCGTCGTCTCCTGCGCCGACGTCCTCGCCCTCGCCGCCAGGGAC
TACGTCCAGCAG
GTACGTATAGTATATACCTGCGCAAGCCGACCGAGAGAGCCTTGGGCTCCGGCGACGGCGAGACTGTTTTTGAGTAACGTACAGTATTATGCAACCGAAAGCAGGAGC
AGTCTGAGGCTGTGAGCCTTGAATTCCGGCGAGAGAAACCGACGTGGCTCTCTAGCGCAGCAGCCGGGCTTGCAAGTTGCAACTGAAACGCAACCGCCAGTACTTAAAGTTGGTAGGGGT
ACATTGGCAAGATAGGACCAGAGCGAGAGGCGACGCCGGGGACGGGCCGGGCAAGAAAAGTTTTACCTGCTTTGGTATGCTTTTTGCACTGCATGCTGAAAAAGGCGCAGCCGGCCACTG
CACAGTGCCGGTGGCCGGCGTGTGAAAAAACGTCGTTAGGAACAGGGCGTGTGTTATTAGCTTGGGTCATTAAGCAGGCCGGTCAGGTGCGCTGATCATGATTACGTGACCGTAAAGATA
ATCGCACCGTGTTTATCCTATCCTTTCAGCAAGGTTCTGCAACTGCCATATTGATCATCATTCATCGTAGTAGTAGCACTACTCTGTGGTCGGTGATATATCTCGCCATCAGTAGGGCTT
GTGGCTTATGGGCTTGTGCCTATTGCCTATACAAAAGCAGATTAGGACGATCAATGGCTTTTAATTCACGTTACGTAACGGGAATTTAACTGGCACGAGTAGAACACTGTCTGCACCATT
TTTAATTTGTTGATTTTGCGTTGTCTGAACAGTTACCTGATCTGGTAGGCGCTACCGGCTATGGAGACAAAATGTCGGCTAATTCCATTTGGGCTAACCTTGGAGATTCGCCACTCTCTT
GGATCCTGGTCGCAAGGCACCAAAGATTTGCCTCAGCCGTGTCAATGCCAGCTGATTTGGTGCTGCCACGAGCTAATTTAGGGCCACATGTGTGGTGTTCTATACGTGTCGCACACTCTC
ACTGCCACGGCAAATACCTAACCATCACAGGTGACGCTTGACAGGTGGTCTTAGGCTCTTAGCCCCGTCCATCAGCCTCTGAGCAGGTCAAGTGGCGTCTTCTTCCCTCCCTCGCAATAG
TCAAGCGTCCAACCTGGCCCTCGCTTTGTTCTGTAGCACGGGCAGCCGTCTCTGGAATCGGCCCGCGCATCTTTCCGGACCACGTTGCCTTGCTAGGTCCTAACCTAGGAAAATGCCCAA
TCCTGCAGCAGTACTACAGCAAAATGAAACCTACGGCTCATACTTTTTGTTCATTTTTTTTCTCTCGTTTGGAGGACACGAACATTTCCCAAAATTTATTTTGAGCCTAAAAAAGAGAGT
GGTGATTGGTTTGACTAACATCGTTTTTGAAGGGGAAAAAAACTAATCCACGCCCTAAAGGGCTAAAGGCCGCGGACCTAGTTGGTTGGGCCCAACAATAAGAGCCCGTCACAATTTGAT
TGACCTTCTGTTACTACGCAGGCTGGTGGGCCGTACTACCCGGTGAAGAAGGGCCGGAAGGACAGCAAGGTGTCCCTGGCGGGGAAGGTCCGCGGCAGCCTGCCCCGCTCCAACTCGACG
GTGGACGAGCTCCTCCGCGTGTTCGCCGGCAAGGGCCTGGGCACGGCGGACCTGGTGGCGCTCTCCGGCGCGCACACCGTGGGCTTCGCGCACTGCGTCCACGTGCTGGGCCGCATCTAC
GACTTCCGCGGCACGCGGCGGCCCGACCCGCTCATGGACGCCCGCCTGGTGAAGGCGCTCCGCATGTCGTGCCCGTCCTCGGGCGGCAGCGCCCGCGTGGTGGTGCCCTTCGACGTGAGC
ACCCCGTTCCAGTTCGACCATGCCTACTACGCCAACCTGCAGGCGCGGCTGGGCCTGCTGGGGTCGGACCAGGCGCTGTCCCAGGACCCGCGGACCAGGGCGATGGCGCAGGAACTCGCC
GGCAACAAGACGCGCTTCTTCCAGGCGTTCGTGGCCAGCATGGACCGGATGGGATCCATCCGGATCAAGAAGGGCAGGAAGGGGGAGATCAGGAAAGTCTGCAGCCAGCACCTGCTTGCA
GTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATTCCTCTCGAGGCACCCGCATCCGCCGTCGCGTCACCTTGTTCCTCCTGCTGCTCGTCGCGTCGTCCCTCGTCGGGACGTCGCGCGCCAGGGAGGCGCAGCCGCTGCCGACCGCG
GCGGCCGGCGGTGGGAGCAGGCGGGCGCCGGAGCGGCACGGGCTGTCGCTGGACTTCTACGCCAAGACGTGCCCCGCGGTCGACCAGATCGTCGCCAGCGTCACCGCCGCACGGTACAAG
GACTTCCCCGCCGCCGGACCCGCCGTGCTCCGCCTCTTCCACCACGACTGCTTCGTCGAA
GGCTGCGACGCGTCCATCCTGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTGCGGCG
CCCACGGTGGAGCGCGACATGGAGGAGAACAAGAACCTGCCGCAGGAGGCGTTCGACACAGTGGAGCTGGCCAAGGCCGCCGTGGAGAGCAAGTGCCCCGGCGTCGTCTCCTGCGCCGAC
GTCCTCGCCCTCGCCGCCAGGGACTACGTCCAGCAG
GCTGGTGGGCCGTACTACCCGGTGAAGAAGGGCCGGAAGGACAGCAAGGTGTCCCTGGCGGGGAAGGTCCGCGGCAGCCTGCCC
CGCTCCAACTCGACGGTGGACGAGCTCCTCCGCGTGTTCGCCGGCAAGGGCCTGGGCACGGCGGACCTGGTGGCGCTCTCCGGCGCGCACACCGTGGGCTTCGCGCACTGCGTCCACGTG
CTGGGCCGCATCTACGACTTCCGCGGCACGCGGCGGCCCGACCCGCTCATGGACGCCCGCCTGGTGAAGGCGCTCCGCATGTCGTGCCCGTCCTCGGGCGGCAGCGCCCGCGTGGTGGTG
CCCTTCGACGTGAGCACCCCGTTCCAGTTCGACCATGCCTACTACGCCAACCTGCAGGCGCGGCTGGGCCTGCTGGGGTCGGACCAGGCGCTGTCCCAGGACCCGCGGACCAGGGCGATG
GCGCAGGAACTCGCCGGCAACAAGACGCGCTTCTTCCAGGCGTTCGTGGCCAGCATGGACCGGATGGGATCCATCCGGATCAAGAAGGGCAGGAAGGGGGAGATCAGGAAAGTCTGCAGC
CAGCACCTGCTTGCAGTCTGA

Retrieve as FASTA