Entry information : SiPrx07 (Si002014m)
Entry ID 9441
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx07 (Si002014m)
Name (synonym) SiPrx07 (Si002014m)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx07
start..stop
S start..stop
SbPrx69 579 0 1..354 1..359
ZmPrx139 567 0 20..356 22..357
PviPrx03 564 0 27..347 20..343
OsPrx23 551 0 5..356 4..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46888006..46888461 456 N° 2 46888543..46889157 615  
join(46888006..46888461,46888543..46889157)


exon

Literature and cross-references SiPrx07 (Si002014m)
DNA ref. Phytozome 12:   scaffold_5 (46888006..46889157)
Protein sequence: SiPrx07 (Si002014m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (332)
PWM (Da):   %s   37695.27 (35366.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.33 (8.22) Peptide Signal:   %s   cut: 25 range:25-356
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARVASTVAAAVALLAALLCGASAAPNGGGDVGQPPVARGLSFDFYKRSCPRAEAIVRSFVQDAVRWDTGLAAGLLRLHFHDCFVQGCDASVLLDGSATGPGEKQAPPNLTLRPSAFKAINDIHDRLTRECGGPVVSCSDVLALAARDSVVVSGGPSYRVPLGRRDSTSFATQQDVLGGLPPPTATVPALLGVLSKINLDATDLVALSGGHTIGLGHCTSFEGRLFPRPDPTLNATFAGHLRQTCPAKGTDRRTPLDVRTPNTFDNKYYVNLVNREGLFTSDQDLFTNPATRPVVDKFAQNQKAFFDQFGSSMIKMGQIKVLTGSQGQIRRNCSARNPGTAGLPWSILEEAESLIF*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGTGTTGCGTCTACGGTCGCTGCCGCGGTGGCGCTGCTAGCTGCCCTCCTCTGCGGCGCCTCTGCCGCGCCCAACGGCGGCGGCGACGTCGGCCAGCCGCCGGTGGCGCGTGGC
CTGTCCTTCGACTTCTACAAGCGGAGCTGCCCCAGGGCGGAGGCCATCGTGCGGAGCTTCGTGCAGGACGCGGTGCGCTGGGACACCGGCCTCGCCGCGGGGCTCCTGCGACTCCACTTC
CACGACTGCTTCGTCCAGGGCTGCGACGCCTCCGTGCTGCTGGACGGCTCCGCCACCGGCCCCGGCGAGAAGCAGGCGCCGCCCAACCTCACGCTCCGCCCCTCCGCCTTCAAGGCCATC
AACGACATCCACGACCGCCTCACCAGGGAGTGCGGAGGACCCGTCGTCTCATGCTCCGACGTCCTCGCGCTCGCCGCCCGCGACTCCGTAGTCGTG
GTACGGTACATGAACTACGCGTGC
TCTGTTCTACTACCTCTGCTTAATTTTACCAACACCTGCTGATCGATGTGCATGCAGTCGGGAGGGCCGAGCTACCGGGTGCCCCTTGGCCGGCGCGACAGCACCAGCTTCGCGACGCAG
CAGGACGTCCTCGGCGGCCTGCCGCCGCCGACCGCCACCGTCCCGGCGCTCCTCGGCGTGCTGTCCAAGATCAACCTGGACGCCACCGACCTGGTGGCTCTCTCCGGCGGCCACACCATC
GGGCTCGGCCACTGCACCTCCTTCGAGGGCCGCCTCTTCCCGCGCCCGGACCCCACCCTCAACGCCACCTTCGCCGGCCACCTCAGGCAGACCTGCCCGGCCAAGGGCACCGACCGGAGG
ACGCCGCTGGACGTCCGCACCCCCAACACCTTCGACAACAAGTACTACGTCAACCTGGTGAACCGGGAGGGGCTCTTCACCTCCGACCAGGACCTCTTCACCAACCCGGCAACAAGGCCC
GTTGTCGACAAGTTCGCGCAGAACCAGAAGGCCTTCTTCGACCAGTTCGGCTCCTCCATGATCAAGATGGGGCAGATCAAGGTGCTCACGGGGTCGCAGGGCCAGATCCGCAGGAACTGC
TCCGCGCGCAACCCTGGCACCGCTGGCCTGCCATGGTCCATCCTCGAGGAAGCAGAGAGCCTCATCTTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGTGTTGCGTCTACGGTCGCTGCCGCGGTGGCGCTGCTAGCTGCCCTCCTCTGCGGCGCCTCTGCCGCGCCCAACGGCGGCGGCGACGTCGGCCAGCCGCCGGTGGCGCGTGGC
CTGTCCTTCGACTTCTACAAGCGGAGCTGCCCCAGGGCGGAGGCCATCGTGCGGAGCTTCGTGCAGGACGCGGTGCGCTGGGACACCGGCCTCGCCGCGGGGCTCCTGCGACTCCACTTC
CACGACTGCTTCGTCCAGGGCTGCGACGCCTCCGTGCTGCTGGACGGCTCCGCCACCGGCCCCGGCGAGAAGCAGGCGCCGCCCAACCTCACGCTCCGCCCCTCCGCCTTCAAGGCCATC
AACGACATCCACGACCGCCTCACCAGGGAGTGCGGAGGACCCGTCGTCTCATGCTCCGACGTCCTCGCGCTCGCCGCCCGCGACTCCGTAGTCGTG
TCGGGAGGGCCGAGCTACCGGGTG
CCCCTTGGCCGGCGCGACAGCACCAGCTTCGCGACGCAGCAGGACGTCCTCGGCGGCCTGCCGCCGCCGACCGCCACCGTCCCGGCGCTCCTCGGCGTGCTGTCCAAGATCAACCTGGAC
GCCACCGACCTGGTGGCTCTCTCCGGCGGCCACACCATCGGGCTCGGCCACTGCACCTCCTTCGAGGGCCGCCTCTTCCCGCGCCCGGACCCCACCCTCAACGCCACCTTCGCCGGCCAC
CTCAGGCAGACCTGCCCGGCCAAGGGCACCGACCGGAGGACGCCGCTGGACGTCCGCACCCCCAACACCTTCGACAACAAGTACTACGTCAACCTGGTGAACCGGGAGGGGCTCTTCACC
TCCGACCAGGACCTCTTCACCAACCCGGCAACAAGGCCCGTTGTCGACAAGTTCGCGCAGAACCAGAAGGCCTTCTTCGACCAGTTCGGCTCCTCCATGATCAAGATGGGGCAGATCAAG
GTGCTCACGGGGTCGCAGGGCCAGATCCGCAGGAACTGCTCCGCGCGCAACCCTGGCACCGCTGGCCTGCCATGGTCCATCCTCGAGGAAGCAGAGAGCCTCATCTTCTAG

Retrieve as FASTA