Entry information : SiPrx09 (Si002052m)
Entry ID 9443
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx09 (Si002052m)
Name (synonym) SiPrx09 (Si002052m)
Class Class III peroxidase    [Orthogroup: Prx079]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx09
start..stop
S start..stop
ZmPrx107 654 0 1..347 1..348
SbPrx58 649 0 1..347 1..348
SiPrx08 641 0 1..347 1..348
ZmPrx44 641 0 1..347 1..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2861215..2861442 228 N° 2 2861608..2862423 816  
join(2861215..2861442,2861608..2862423)


exon

Literature and cross-references SiPrx09 (Si002052m)
DNA ref. Phytozome 12:   scaffold_5 (2861215..2862423)
Protein sequence: SiPrx09 (Si002052m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (319)
PWM (Da):   %s   38262.49 (35394.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.37 (6.23) Peptide Signal:   %s   cut: 29 range:29-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSAAVLFALVAVQAAVLLAAVPSAQAGELQVGYYSKKCRGLENVVKWHVIRALKANRRTGAALVRLLFHDCFVRGCDGSVLLDASYDNPHPEKEAPVNIGLAAFDLLEEIKAAVEDRCPDVVSCSDILIYAARDAASILSNGHVHFDVPAGRLDGFVSKAEEAQAELPDSADDVQKLIDNFARKNFTIEELVILSGAHSIGQGHCSSFTGRLSEPNDQITPAYRNLLKYKCAKGNPPVDNNVRDEDYDVVARFMPGFTSRVRKIPDFLDNSYYHNNLAKIVTFHSDWTLLTHKEAFGHVKEYAENGTLWDEDFAESLVKLSELPMPAGSKGEIRKKCSVINHRLY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGGCGGCTGTGCTCTTCGCCCTTGTGGCCGTCCAGGCGGCGGTGCTCCTCGCCGCCGTGCCGTCAGCGCAGGCCGGCGAGCTGCAGGTCGGGTACTACAGCAAGAAATGC
AGGGGCCTGGAGAACGTCGTCAAGTGGCACGTCATCAGGGCGCTCAAGGCTAACCGCCGCACCGGCGCCGCTCTTGTCCGCCTCCTCTTCCATGACTGCTTCGTCAGG
GTAAGCACACAC
ATTCGCATGCTGATCTCACCTTCTAATATAGTTTCATGCATCGGCAATTCACCTAACCTAGTTTAACCATGTGCGGTTGTTCAATGCACGTAGCCAGTAACTACGGGTAATTAAAATGGG
CATGGAAGTTAATGATTTGTTACTTTTATGCAGGGGTGCGATGGCTCTGTCCTCCTGGACGCGTCCTACGACAACCCTCACCCGGAGAAGGAGGCGCCGGTGAACATCGGCCTCGCCGCC
TTCGACCTTCTGGAGGAGATCAAGGCCGCTGTCGAGGACAGGTGCCCTGACGTCGTTTCCTGCTCCGACATCCTCATCTACGCCGCCCGTGACGCGGCCAGCATCCTCAGCAACGGCCAC
GTCCACTTCGACGTCCCCGCCGGCCGCCTCGACGGCTTCGTCTCCAAGGCCGAGGAGGCCCAGGCGGAGCTCCCCGACTCCGCTGACGACGTTCAGAAGCTCATCGACAACTTCGCCAGG
AAGAACTTCACCATCGAGGAGCTCGTCATCCTCTCCGGCGCGCACTCCATCGGCCAGGGCCACTGCTCGTCCTTCACCGGCCGCCTCTCCGAGCCCAATGACCAGATCACCCCGGCCTAC
CGCAACCTCCTCAAGTACAAGTGCGCCAAGGGCAACCCCCCCGTGGACAACAACGTCCGCGACGAGGACTACGACGTCGTGGCGAGGTTCATGCCGGGGTTCACCAGCCGTGTTCGCAAG
ATCCCCGACTTCCTTGACAACTCGTACTACCACAACAACCTCGCCAAGATCGTCACCTTCCACTCCGACTGGACGCTGCTGACGCACAAGGAGGCGTTCGGCCATGTCAAGGAGTACGCC
GAGAACGGCACTCTCTGGGACGAGGACTTCGCCGAGTCGCTGGTTAAGCTCAGCGAGCTGCCCATGCCGGCCGGGAGCAAGGGCGAGATCAGGAAGAAGTGCAGCGTCATCAACCACCGC
CTGTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGGCGGCTGTGCTCTTCGCCCTTGTGGCCGTCCAGGCGGCGGTGCTCCTCGCCGCCGTGCCGTCAGCGCAGGCCGGCGAGCTGCAGGTCGGGTACTACAGCAAGAAATGC
AGGGGCCTGGAGAACGTCGTCAAGTGGCACGTCATCAGGGCGCTCAAGGCTAACCGCCGCACCGGCGCCGCTCTTGTCCGCCTCCTCTTCCATGACTGCTTCGTCAGG
GGGTGCGATGGC
TCTGTCCTCCTGGACGCGTCCTACGACAACCCTCACCCGGAGAAGGAGGCGCCGGTGAACATCGGCCTCGCCGCCTTCGACCTTCTGGAGGAGATCAAGGCCGCTGTCGAGGACAGGTGC
CCTGACGTCGTTTCCTGCTCCGACATCCTCATCTACGCCGCCCGTGACGCGGCCAGCATCCTCAGCAACGGCCACGTCCACTTCGACGTCCCCGCCGGCCGCCTCGACGGCTTCGTCTCC
AAGGCCGAGGAGGCCCAGGCGGAGCTCCCCGACTCCGCTGACGACGTTCAGAAGCTCATCGACAACTTCGCCAGGAAGAACTTCACCATCGAGGAGCTCGTCATCCTCTCCGGCGCGCAC
TCCATCGGCCAGGGCCACTGCTCGTCCTTCACCGGCCGCCTCTCCGAGCCCAATGACCAGATCACCCCGGCCTACCGCAACCTCCTCAAGTACAAGTGCGCCAAGGGCAACCCCCCCGTG
GACAACAACGTCCGCGACGAGGACTACGACGTCGTGGCGAGGTTCATGCCGGGGTTCACCAGCCGTGTTCGCAAGATCCCCGACTTCCTTGACAACTCGTACTACCACAACAACCTCGCC
AAGATCGTCACCTTCCACTCCGACTGGACGCTGCTGACGCACAAGGAGGCGTTCGGCCATGTCAAGGAGTACGCCGAGAACGGCACTCTCTGGGACGAGGACTTCGCCGAGTCGCTGGTT
AAGCTCAGCGAGCTGCCCATGCCGGCCGGGAGCAAGGGCGAGATCAGGAAGAAGTGCAGCGTCATCAACCACCGCCTGTACTAA

Retrieve as FASTA