Entry information : SiPrx10 (Si002053m)
Entry ID 9444
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx10 (Si002053m)
Name (synonym) SiPrx10 (Si002053m)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx10
start..stop
S start..stop
SbPrx52 669 0 1..347 1..347
ZmPrx46 615 0 1..347 1..353
BdiPrx53 608 0 1..345 1..346
OsPrx05 594 0 1..347 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4713905..4714168 264 N° 2 4714378..4714569 192 N° 3 4714761..4714926 166 N° 4 4715286..4715707 422
join(4713905..4714168,4714378..4714569,4714761..4714926,4715286..4715707)


exon

Literature and cross-references SiPrx10 (Si002053m)
DNA ref. Phytozome 12:   scaffold_5 (4713905..4715707)
Protein sequence: SiPrx10 (Si002053m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348
PWM (Da):   %s   38300.59 Transmb domain:   %s   i7-24o
PI (pH):   %s   7.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTKIVLGAIFIASFYLSASLAFPPGHHEGAYPVGNGPVSGLSPDYYKFTCPQADEIVVSILKKAIAKEPRIGASLLRLLFHDCFVQGCDASVLLDDTEEVVSEKNAIPNKNSIRGFEVIDEIKAALEEACPHTVSCADTIALAARGSTVLSGGPYWELPLGRRDSKTANMKLANKYLPPPNATLHRLIKFFQRQGLDKVDLVALSGSHTIGKARCVSFKQRLYNQHRDNRPDITLEKSFYHTLALACPHTGGDNNIRSLDFVSPSKFDNSYYKLIMEGRGLLNSDEVLWTGKDPEIAGLVKSYAENEPLFFEHYVNSITKMGNINPLMGHNGEIRKNCRRVNQEI*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAACTAAGATAGTTCTTGGTGCAATCTTCATTGCTTCCTTCTACTTATCTGCCTCCCTCGCCTTCCCTCCCGGTCACCATGAGGGTGCCTATCCAGTTGGAAATGGCCCAGTC
TCAGGTCTTTCTCCAGATTACTACAAGTTCACATGCCCACAAGCCGATGAGATTGTGGTATCTATACTAAAGAAGGCTATAGCAAAGGAACCACGGATAGGTGCTTCCCTTCTCAGGCTC
CTATTTCATGACTGCTTCGTTCAG
GTTAGTACAATTCAAATCCATTTCCTTTTTCATCTGGAATGAACAAAACTCACCAGTCACCAAGCATAGTTCGCCCATGAGCTGGGACATTGAACA
TGGTTGAGTGCTAGAACCACGCTTTCATGTTCAGTCATCAATAATCTTGGTTATCTTGTGGTATACGTAGTGTTGTAGATCAAAGTTATTTTCTCATCAGGATGAAATTGCAGGGCTGTG
ATGCATCTGTTCTTTTGGATGACACTGAGGAAGTTGTAAGCGAGAAAAATGCTATTCCCAATAAGAATTCTATTAGGGGATTTGAGGTTATAGATGAGATCAAAGCCGCACTTGAAGAAG
CATGCCCACATACAGTCTCCTGTGCTGACACTATTGCCCTAGCAGCCAGAGGTTCAACAGTACTG
GTAAATTTCTGTTCTTTGAAGTGACAAGAACATGTACTAATTACAGAAAGAGAAA
TAAATACAAGGATTCTTACTAAAACATTTTTGTTTATTTTCTTTGAAAAGACTAAAAGCTGGCATCCTCAGGTAGAACTTAATTTAGCTCCACTTGATATATTTAACATGCACATAATAC
TGTTATTGCCTCACAGAGTGGTGGACCATACTGGGAACTTCCATTAGGAAGGAGGGATTCAAAGACAGCAAACATGAAGCTAGCAAATAAGTACCTTCCTCCACCAAATGCAACACTACA
CCGTCTTATCAAGTTTTTCCAAAGGCAAGGACTGGATAAGGTGGACCTTGTGGCACTATCAG
GTATGCTATCGGTGCATCTTCAATGTTGAAAATAAACCTTCGATAAAAAACTGTGAAT
GGAATTGGTTCAGTTGTTCATAATTCTATGAGATTCTTGCTATAAGCTTACGGCTGAAAGTACACAGGATATAATAGAAAGGTGTTATTATCATTAGCAAGAATATCTGTCAGACAAGAA
GGAAAAATACAAAATAACAAAAGTATTAATAACCATAAAGGATTTATTGATGTTTCATTGGCGTCATGAATCTAGCACTGAAATTAAACAGTACTCCAAATTGATTTTTAAGAACATAAC
TGTTGCTATTGTATCTGCATATTCTCTTCTCTTATTAAAGAGTTATATTTTAAACTGACAGGAAGCCACACCATCGGAAAGGCAAGATGTGTGAGTTTCAAACAACGGCTCTACAATCAA
CATAGAGATAACAGACCAGACATCACGCTGGAGAAAAGTTTCTATCACACATTGGCATTGGCGTGCCCACACACTGGTGGTGATAACAACATACGGTCACTAGATTTTGTCAGCCCTTCA
AAATTTGACAACAGCTATTATAAGCTGATAATGGAGGGAAGAGGGCTTCTCAATTCAGATGAAGTTTTGTGGACAGGAAAAGACCCAGAAATAGCAGGGCTGGTTAAAAGTTATGCAGAA
AACGAGCCACTATTCTTTGAACATTATGTGAATTCAATAACCAAAATGGGGAACATAAATCCCCTCATGGGTCACAATGGAGAAATCCGCAAGAACTGTCGTAGGGTTAATCAGGAGATC
TAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAACTAAGATAGTTCTTGGTGCAATCTTCATTGCTTCCTTCTACTTATCTGCCTCCCTCGCCTTCCCTCCCGGTCACCATGAGGGTGCCTATCCAGTTGGAAATGGCCCAGTC
TCAGGTCTTTCTCCAGATTACTACAAGTTCACATGCCCACAAGCCGATGAGATTGTGGTATCTATACTAAAGAAGGCTATAGCAAAGGAACCACGGATAGGTGCTTCCCTTCTCAGGCTC
CTATTTCATGACTGCTTCGTTCAG
GGCTGTGATGCATCTGTTCTTTTGGATGACACTGAGGAAGTTGTAAGCGAGAAAAATGCTATTCCCAATAAGAATTCTATTAGGGGATTTGAGGTT
ATAGATGAGATCAAAGCCGCACTTGAAGAAGCATGCCCACATACAGTCTCCTGTGCTGACACTATTGCCCTAGCAGCCAGAGGTTCAACAGTACTG
AGTGGTGGACCATACTGGGAACTT
CCATTAGGAAGGAGGGATTCAAAGACAGCAAACATGAAGCTAGCAAATAAGTACCTTCCTCCACCAAATGCAACACTACACCGTCTTATCAAGTTTTTCCAAAGGCAAGGACTGGATAAG
GTGGACCTTGTGGCACTATCAG
GAAGCCACACCATCGGAAAGGCAAGATGTGTGAGTTTCAAACAACGGCTCTACAATCAACATAGAGATAACAGACCAGACATCACGCTGGAGAAAAGT
TTCTATCACACATTGGCATTGGCGTGCCCACACACTGGTGGTGATAACAACATACGGTCACTAGATTTTGTCAGCCCTTCAAAATTTGACAACAGCTATTATAAGCTGATAATGGAGGGA
AGAGGGCTTCTCAATTCAGATGAAGTTTTGTGGACAGGAAAAGACCCAGAAATAGCAGGGCTGGTTAAAAGTTATGCAGAAAACGAGCCACTATTCTTTGAACATTATGTGAATTCAATA
ACCAAAATGGGGAACATAAATCCCCTCATGGGTCACAATGGAGAAATCCGCAAGAACTGTCGTAGGGTTAATCAGGAGATCTAG

Retrieve as FASTA