Entry information : SiPrx101 (Si022700m)
Entry ID 9446
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx101 (Si022700m)
Name (synonym) SiPrx101 (Si022700m)
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx101
start..stop
S start..stop
SbPrx124 525 0 1..317 1..323
SiPrx100 508 0 36..317 37..318
SbPrx120 500 1e-180 1..313 1..317
ZmPrx135 499 3e-180 26..317 34..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19555732..19556166 435 N° 2 19555479..19555641 163 N° 3 19555014..19555369 356  
complement(join(19555014..19555369,19555479..19555641,19555732..19556166))


exon

Literature and cross-references SiPrx101 (Si022700m)
DNA ref. Phytozome 12:   scaffold_3 (19556166..19555014)
Protein sequence: SiPrx101 (Si022700m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (289)
PWM (Da):   %s   34131.03 (31204.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.03 (5.60) Peptide Signal:   %s   cut: 29 range:29-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSPCFSLLVLLLAAHCGLLLASAHGYPGGSALSSTFYDASCPSAHDVVRRVIQDARVSDPRIPASLIRLHFHDCFVQGCDGSLLLDDDLPAIQTEKNVPANDRSARGFPVVDDIKAALEHACPGIVSCADILALAAEISVELAGGPRWSVLLGRRDGTTTNVQSADNLPSPFDSLDVLQEKFRNVNLDDTDLVALQGAHTFGKVQCQFTRQNCTAGQPVDSLENLDQATPNLFDNKYYGNLLHGRAQLESDQVMLSDPAAPATTAPIVHRFASNQKDFFRNFAASMIKMGNISPLTGKDGEIRKNCRRVNSKGY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTCTTCCCCCTGCTTCTCGCTGCTCGTGTTGTTGCTAGCGGCGCACTGCGGGCTCCTGCTCGCCTCGGCTCACGGTTACCCTGGCGGCTCAGCGCTGAGCTCCACGTTCTAC
GACGCGTCGTGCCCGAGCGCCCACGACGTCGTCCGCCGCGTGATCCAGGACGCCCGGGTCTCCGACCCGCGCATCCCGGCCAGCCTCATCCGACTCCACTTCCACGACTGCTTCGTTCAG
GGCTGCGACGGCTCGCTCCTCCTGGACGACGACCTCCCGGCGATCCAGACCGAGAAGAACGTGCCCGCCAACGACAGGTCGGCGCGCGGCTTTCCCGTCGTCGACGACATCAAGGCCGCG
CTGGAGCACGCGTGCCCCGGCATCGTCTCCTGCGCTGACATCCTTGCCCTCGCGGCCGAGATCTCCGTCGAACTC
GTAAGCGCCGCCGCGACCTTCTTGCATTGATCAGCACAGCCTTTC
CTAGCTTCTCTCCTCACACCTGAACTGACGGAATCACGGTTACAGGCTGGAGGGCCACGATGGAGTGTGCTGCTCGGCCGGCGAGACGGCACGACGACCAACGTCCAGAGCGCCGACAAC
CTCCCGAGCCCTTTCGACTCCCTCGACGTTCTCCAGGAGAAGTTCAGAAACGTCAACCTCGATGACACTGACCTCGTCGCCCTCCAAG
GTAACGTAAACGTACCGAGTCAAAAAAATTTC
AGTTTTCATCAATGTAACTTTGTGTACACAGTTCAAACCTAGAACACTATTTCAACAACAAATTTCTACTACTCCAGGAGCGCACACGTTTGGCAAAGTGCAGTGTCAGTTCACGCGGCA
GAACTGCACGGCCGGGCAACCCGTGGATTCACTGGAGAACCTGGACCAGGCGACACCCAACCTGTTCGACAACAAGTATTACGGAAACCTCTTGCACGGCCGCGCCCAGCTCGAATCCGA
CCAGGTCATGCTGTCGGACCCAGCTGCGCCGGCGACAACTGCACCCATTGTTCACCGATTCGCGAGCAACCAGAAGGATTTCTTCAGGAACTTCGCGGCGTCCATGATTAAGATGGGGAA
CATTAGCCCTCTGACTGGGAAGGATGGAGAGATCAGGAAGAACTGCCGGAGGGTCAATAGCAAAGGTTATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTCTTCCCCCTGCTTCTCGCTGCTCGTGTTGTTGCTAGCGGCGCACTGCGGGCTCCTGCTCGCCTCGGCTCACGGTTACCCTGGCGGCTCAGCGCTGAGCTCCACGTTCTAC
GACGCGTCGTGCCCGAGCGCCCACGACGTCGTCCGCCGCGTGATCCAGGACGCCCGGGTCTCCGACCCGCGCATCCCGGCCAGCCTCATCCGACTCCACTTCCACGACTGCTTCGTTCAG
GGCTGCGACGGCTCGCTCCTCCTGGACGACGACCTCCCGGCGATCCAGACCGAGAAGAACGTGCCCGCCAACGACAGGTCGGCGCGCGGCTTTCCCGTCGTCGACGACATCAAGGCCGCG
CTGGAGCACGCGTGCCCCGGCATCGTCTCCTGCGCTGACATCCTTGCCCTCGCGGCCGAGATCTCCGTCGAACTC
GCTGGAGGGCCACGATGGAGTGTGCTGCTCGGCCGGCGAGACGGC
ACGACGACCAACGTCCAGAGCGCCGACAACCTCCCGAGCCCTTTCGACTCCCTCGACGTTCTCCAGGAGAAGTTCAGAAACGTCAACCTCGATGACACTGACCTCGTCGCCCTCCAAG
GA
GCGCACACGTTTGGCAAAGTGCAGTGTCAGTTCACGCGGCAGAACTGCACGGCCGGGCAACCCGTGGATTCACTGGAGAACCTGGACCAGGCGACACCCAACCTGTTCGACAACAAGTAT
TACGGAAACCTCTTGCACGGCCGCGCCCAGCTCGAATCCGACCAGGTCATGCTGTCGGACCCAGCTGCGCCGGCGACAACTGCACCCATTGTTCACCGATTCGCGAGCAACCAGAAGGAT
TTCTTCAGGAACTTCGCGGCGTCCATGATTAAGATGGGGAACATTAGCCCTCTGACTGGGAAGGATGGAGAGATCAGGAAGAACTGCCGGAGGGTCAATAGCAAAGGTTATTGA

Retrieve as FASTA