Entry information : SiPrx112 (Si026644m)
Entry ID 9457
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx112 (Si026644m)
Name (synonym) SiPrx112 (Si026644m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx112
start..stop
S start..stop
SiPrx54 627 0 1..321 1..321
SiPrx111 578 0 10..321 18..331
SbPrx144 577 0 10..321 6..320
SbPrx83 575 0 21..321 31..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 894593..894808 216 N° 2 894312..894503 192 N° 3 894060..894225 166 N° 4 892825..893216 392
complement(join(892825..893216,894060..894225,894312..894503,894593..894808))


exon

Literature and cross-references SiPrx112 (Si026644m)
DNA ref. Phytozome 12:   scaffold_8 (894808..892825)
Protein sequence: SiPrx112 (Si026644m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   33644.79 (31233.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.93 (7.70) Peptide Signal:   %s   cut: 26 range:26-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAARCSGGGIALVLLLLALAGTSSAQLSTGFYSSSCPGVYSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDGSLLLDDTPSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPNWNVKVGRRDSMTASFSGANNSIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLARCTNFRAHVYNETNIDGALARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENNYYKNLVSKKGLLHSDQELFNGGATDAQVQSYVSSQSAFFADFVTGMIKMGDITPLTGSNGEIRKNCRRIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAAGATGCAGCGGCGGCGGCATCGCTCTCGTACTGTTGCTCCTGGCGCTGGCCGGCACCTCGTCGGCGCAGCTGTCCACCGGCTTCTACTCCAGCTCCTGCCCCGGCGTGTAC
AGCGCCGTCAAGTCGGTGGTGCAGTCCGCCATCGACAAGGAGAAGCGCATGGGCGCCTCCATCGTTCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GTACTTCTACTGATATGCATGATG
AATTAGTACTGATATGCATGATGAATTAGTACTGATCAACTTGATGACCTACAACTGCGTGTCAGGGTTGCGACGGGTCGCTGCTGCTGGATGACACGCCCAGCTTCCAGGGTGAGAAGA
TGGCGACGCCAAACAACGGCTCCGTGAGAGGCTTCGAGGTCATCGATGCCATCAAGTCCGCCGTCGAGAAGGTCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATCGCGGCGA
GGGACAGCGTCGTCATC
GTAAGTGTGAAGCTAGCTGATGATGAACTTGATTGGCAGTAACAACATGCATGTCGCAACTCCATCTCAACTGATCGCACATGCAGCTTGGCGGGCCGAACTG
GAACGTCAAGGTTGGGAGGAGGGACTCGATGACGGCGAGCTTCAGTGGAGCCAACAACAGCATCCCACCGCCGACGTCGGGCCTCGCCAACCTGACATCCCTCTTCGCCGCGCAGGGACT
CTCCCAAAAGGACATGGTCGCGCTCTCTG
GTACGTCGTCAGGCTAAACTCTTGCACAAATTCCTACTTAGACATGTTCAACTTCAACTATGGATGGCATCTTTTTGGATATCAACTGTAG
AATGAGAAAATAAAGTAAACTCCACACTTTGCTTTTCAACAAAGATAGCTTTAGAGATTAGATAAATCGCCAACGGAATCGATAGCTCAGTTTTGACTTTAACCGTCGTCATATAATTGT
ATATCAATCCGTGAGTCCGTGACACAGGATCATTTACCTGGCCTGTTGGTGAATTGACCAGATGAAGCTTAATTAACTGTCGGTTACTAACATATAACACGTCTAGCACGAGATCTAGTT
AGTTTAGGTATGGACGGAATGACATAATAAAGTTTGTAAAAGGTGACAACGACGATGCCACAGATGCTGTCGGCCGGTACGGGTTTCATCTGGAAGAAAAAGAAAGTTGTGTGTACAAGC
TTATGCTTTTTGCATGTTATAAAAGAAAGTTGAAAGATGATCAATCAACCATCGGATATGTCAATTCGATGCTATACTGAAGGCAAGCATAAAGTCCATCATCGTAGCTAGCTAGTTAAC
TGCAACCACACAAATTGTTCCTTTTTTTATGTCGCTTCATAACTAGAATCGAATACTCTTTTGTCTCTTATATATTTACAGAATCAACAACAACCACCTGTTTCAAAAAAAAAATGTTAT
AAACTTGTAATATGATTATGTATAGCGAGCAATTTATTTTGCAGAATAAGTAAAAATAGGTCAATCATTCATTTCTTCCATTCTTTTGATATACTAGCTAGATTAATATCATAACCTACT
TGGAATCTTGATCGGCCTCTTGATTTTGGCAGGTGCTCACACCATAGGCCTAGCACGTTGCACCAACTTCAGAGCCCACGTATACAATGAAACCAACATCGATGGCGCCTTAGCAAGGAC
TAGGCAATCAGGCTGCCCTAGCACCTCAGGTACAGGTGACAACAACTTGGCACCTCTGGACCTTCAAACCCCGACCGTCTTCGAGAACAACTACTACAAGAACCTTGTTAGCAAGAAGGG
ACTTCTGCACTCCGATCAGGAGCTCTTCAACGGTGGAGCCACCGACGCGCAGGTCCAATCGTATGTTAGTAGCCAAAGCGCATTTTTCGCAGATTTTGTGACAGGCATGATCAAGATGGG
TGACATTACACCTTTGACGGGCTCCAACGGGGAGATAAGGAAGAACTGCAGAAGGATTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAAGATGCAGCGGCGGCGGCATCGCTCTCGTACTGTTGCTCCTGGCGCTGGCCGGCACCTCGTCGGCGCAGCTGTCCACCGGCTTCTACTCCAGCTCCTGCCCCGGCGTGTAC
AGCGCCGTCAAGTCGGTGGTGCAGTCCGCCATCGACAAGGAGAAGCGCATGGGCGCCTCCATCGTTCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GGTTGCGACGGGTCGCTGCTGCTG
GATGACACGCCCAGCTTCCAGGGTGAGAAGATGGCGACGCCAAACAACGGCTCCGTGAGAGGCTTCGAGGTCATCGATGCCATCAAGTCCGCCGTCGAGAAGGTCTGCCCCGGCGTCGTC
TCCTGCGCCGACATCCTCGCCATCGCGGCGAGGGACAGCGTCGTCATC
CTTGGCGGGCCGAACTGGAACGTCAAGGTTGGGAGGAGGGACTCGATGACGGCGAGCTTCAGTGGAGCCAAC
AACAGCATCCCACCGCCGACGTCGGGCCTCGCCAACCTGACATCCCTCTTCGCCGCGCAGGGACTCTCCCAAAAGGACATGGTCGCGCTCTCTG
GTGCTCACACCATAGGCCTAGCACGT
TGCACCAACTTCAGAGCCCACGTATACAATGAAACCAACATCGATGGCGCCTTAGCAAGGACTAGGCAATCAGGCTGCCCTAGCACCTCAGGTACAGGTGACAACAACTTGGCACCTCTG
GACCTTCAAACCCCGACCGTCTTCGAGAACAACTACTACAAGAACCTTGTTAGCAAGAAGGGACTTCTGCACTCCGATCAGGAGCTCTTCAACGGTGGAGCCACCGACGCGCAGGTCCAA
TCGTATGTTAGTAGCCAAAGCGCATTTTTCGCAGATTTTGTGACAGGCATGATCAAGATGGGTGACATTACACCTTTGACGGGCTCCAACGGGGAGATAAGGAAGAACTGCAGAAGGATT
AACTAA

Retrieve as FASTA