Entry information : SiPrx114 (Si027715m)
Entry ID 9458
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx114 (Si027715m)
Name (synonym) SiPrx114 (Si027715m)
Class Class III peroxidase     [Orthogroup: Prx204]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx114
start..stop
S start..stop
SiPrx19 451 3e-161 1..321 1..322
SbPrx64 437 1e-155 1..321 1..323
SiPrx170 410 8e-145 1..321 1..322
SiPrx155 405 5e-143 4..321 2..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14638297..14638503 207 N° 2 14637377..14638135 759  
complement(join(14637377..14638135,14638297..14638503))


exon

Literature and cross-references SiPrx114 (Si027715m)
DNA ref. Phytozome 12:   scaffold_8 (14638503..14637377)
Protein sequence: SiPrx114 (Si027715m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (298)
PWM (Da):   %s   34569.61 (32029.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.71 (8.75) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATAFRLWLLVSCGLLLAVACHGLQVGFYQKTCPKAEAIVRAEVQKAVRRDPGLGAGLLRMLFHDCFVEGCDASILLDPTQSNPRPEKKGPPNDASQRSYEVIDAAKRALEKACPGAVSCADVVAFAARDASDLLSGSRIRFSMPGGRLDGRRSQESQTGVLPPPFAGLGTLVNRFAAKDMTVEDLVVLSGAHSVGRSHCSSFVFERLTSGSDMDSTLANQLKRQCPANPGVGNDPVVAEDAVTPNVLDNQYYKNLLDRKVLFTSDATLMSSAQTAKMVSEFAKPDRTWEKKFAAAMVKLASIGVKTARDGEIRRNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACAGCTTTTAGGCTATGGCTTCTAGTCTCGTGTGGGCTGCTTCTGGCAGTGGCGTGCCATGGCCTGCAGGTGGGCTTCTACCAGAAGACCTGCCCCAAGGCGGAGGCCATCGTG
AGGGCCGAGGTGCAGAAGGCCGTGCGCAGGGACCCCGGCCTCGGCGCGGGCCTCCTCCGTATGCTCTTCCACGACTGCTTCGTCGAG
GTAAGCATGCGCGCCCATGGCAGCAGATGACCC
AAAAGAACAACATTTTTCTTCTTTTTTGCAACGAAACGAATTTTCTTCTTTTTTAACAATTTATAAACGTGCCAAGTAACTACCTTGCATTGTATGAATCTGATGTAAACACGTCGAATC
CGTAATAGGGTTGTGATGCGTCCATCCTGCTCGACCCGACGCAGTCGAACCCGCGGCCGGAGAAGAAGGGCCCGCCGAACGACGCCAGCCAGCGGAGCTACGAGGTGATCGACGCGGCGA
AGCGCGCCCTGGAGAAGGCCTGCCCCGGGGCGGTGTCCTGCGCCGACGTCGTCGCCTTCGCGGCGCGCGACGCGTCGGACCTCCTCAGCGGCTCGCGGATCCGCTTCTCCATGCCGGGCG
GGCGGCTCGACGGGCGGCGGTCGCAGGAGTCCCAGACGGGGGTCCTGCCGCCGCCGTTCGCCGGCCTCGGCACCCTCGTGAACAGGTTCGCCGCCAAGGACATGACCGTCGAGGACCTCG
TCGTGCTCTCCGGCGCGCACTCCGTCGGCCGGTCGCACTGCTCGTCCTTCGTCTTCGAGCGCCTCACCTCCGGCTCCGACATGGATTCCACCTTGGCCAACCAGCTTAAGAGGCAGTGCC
CGGCGAACCCGGGCGTCGGCAACGACCCGGTGGTGGCGGAGGACGCCGTCACGCCGAACGTGTTGGACAACCAGTACTACAAGAACCTGCTGGACCGGAAGGTGCTCTTCACCTCGGACG
CCACGCTGATGTCGTCGGCGCAGACGGCGAAGATGGTGAGCGAATTCGCGAAGCCGGACAGGACGTGGGAGAAGAAGTTCGCCGCCGCCATGGTGAAGCTAGCGAGCATCGGGGTCAAGA
CCGCCCGGGACGGGGAGATCAGGAGGAACTGCCGGGTCGTGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACAGCTTTTAGGCTATGGCTTCTAGTCTCGTGTGGGCTGCTTCTGGCAGTGGCGTGCCATGGCCTGCAGGTGGGCTTCTACCAGAAGACCTGCCCCAAGGCGGAGGCCATCGTG
AGGGCCGAGGTGCAGAAGGCCGTGCGCAGGGACCCCGGCCTCGGCGCGGGCCTCCTCCGTATGCTCTTCCACGACTGCTTCGTCGAG
GGTTGTGATGCGTCCATCCTGCTCGACCCGACG
CAGTCGAACCCGCGGCCGGAGAAGAAGGGCCCGCCGAACGACGCCAGCCAGCGGAGCTACGAGGTGATCGACGCGGCGAAGCGCGCCCTGGAGAAGGCCTGCCCCGGGGCGGTGTCCTGC
GCCGACGTCGTCGCCTTCGCGGCGCGCGACGCGTCGGACCTCCTCAGCGGCTCGCGGATCCGCTTCTCCATGCCGGGCGGGCGGCTCGACGGGCGGCGGTCGCAGGAGTCCCAGACGGGG
GTCCTGCCGCCGCCGTTCGCCGGCCTCGGCACCCTCGTGAACAGGTTCGCCGCCAAGGACATGACCGTCGAGGACCTCGTCGTGCTCTCCGGCGCGCACTCCGTCGGCCGGTCGCACTGC
TCGTCCTTCGTCTTCGAGCGCCTCACCTCCGGCTCCGACATGGATTCCACCTTGGCCAACCAGCTTAAGAGGCAGTGCCCGGCGAACCCGGGCGTCGGCAACGACCCGGTGGTGGCGGAG
GACGCCGTCACGCCGAACGTGTTGGACAACCAGTACTACAAGAACCTGCTGGACCGGAAGGTGCTCTTCACCTCGGACGCCACGCTGATGTCGTCGGCGCAGACGGCGAAGATGGTGAGC
GAATTCGCGAAGCCGGACAGGACGTGGGAGAAGAAGTTCGCCGCCGCCATGGTGAAGCTAGCGAGCATCGGGGTCAAGACCGCCCGGGACGGGGAGATCAGGAGGAACTGCCGGGTCGTG
AACTAG

Retrieve as FASTA