Entry information : SiPrx123 (Si030428m)
Entry ID 9468
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-07 (Qiang Li)
Peroxidase information: SiPrx123 (Si030428m)
Name (synonym) SiPrx123 (Si030428m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx123
start..stop
S start..stop
ZmPrx29 563 0 1..329 1..335
SbPrx32 553 0 23..330 26..337
OsPrx123 513 0 29..329 32..331
TaPrx13 478 8e-172 1..329 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 36765581..36765805 225 N° 2 36764616..36764807 192 N° 3 36764310..36764531 222 N° 4 36763935..36764285 351
complement(join(36763935..36764285,36764310..36764531,36764616..36764807,3676558 1..36765805))


exon

Literature and cross-references SiPrx123 (Si030428m)
DNA ref. Phytozome 11:   scaffold_2 (36765805..36763935)
Protein sequence: SiPrx123 (Si030428m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (302)
PWM (Da):   %s   34505.28 (31588.6) Transmb domain:   %s   i7-26o
PI (pH):   %s   5.97 (5.38) Peptide Signal:   %s   cut: 29 range:29-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ERWRKRGSLLAVAAVALVAALLPSGEAKLSPDYYRSTCPDVEAIVREAVAKKVNETFVTVPATLRLFFHDCFVEVCDASVIIASRDNDAEKDAPGNVSLAGDGFDTVVRAKAEVEKACPGVVSCADILAIAARDVVTMVSGPHWPVELGRLDGLVSKAGSVAGRLPGPDMRVDDLAALFAKHNLTTLDMVALSGAHTVGFAHCTRFTGRLYXRXXXXSVDPSYDPAYARQLMEACPPDVGATIAVDMDPVTPTAFDNAYYGNLAGGMGLFTSDQALYSDGASRPAVGDFAKNQTRFFEAFKDAMVKLGRVGVKTGRHGEIRRDCTAFNK*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGAGATGGAGAAAACGCGGGAGCTTGCTCGCCGTCGCAGCCGTGGCCCTGGTGGCAGCATTGCTGCCGTCCGGCGAGGCGAAGCTGTCCCCGGACTACTACCGGTCGACGTGCCCGGAC
GTCGAGGCGATCGTGCGGGAGGCGGTGGCCAAGAAGGTCAACGAGACCTTCGTCACTGTCCCAGCCACGCTCAGGCTCTTCTTCCACGACTGCTTCGTCGAGGTG
AGCAACATCCATCGG
TGCCTGCAGCTGCGCATTCTTGAAAATCAGAGGCTATCATGATCGAAATCAAGGATCCATTTAGAACAGCGGAATTTCTAGCAAATTCAGCGGGAATCGAACCGATTCCTGGTGAAAATT
TTGCGTTTTAAAGATTTAGGTTTTGTCAGTTGAAGTTTCTTGGGTTGCAGTCTCGTAGAAAGAGGTTCAGTTCGATCTGCCATGCTTGTAAGTCTGCAGTTTTCAGCGGCTTTCAGATCG
ACTTGCAGCCTACTCCTACTGCTGTCATTAGCTTGCCAATCATCTCATACTGAATTTTTAGATCAGAGTGAATTTGGTTCATCTCAGCAATGGGTAGAAATGATAGAAGCAGGACTGAAT
GACTGATGGGGCCAGTAGATTATTGGTACGAATGACAGCTCGATTGGCTCCTATAATCACACGCTCGTCGGTTCCGCCATGTGACTGCACGACCTTTTCTGTCATCTGGGCTGAATTGTA
TCAGGCATTCAGATCAGATGTGTCGGGCGTCCCTGCTGGCAGATCAGGCACCCATTTTGTCGTTTCCGACGTGGCCGATGCGGAATTTGGCACTGCCAACGTCATCGTTCCGCACTCTCT
CGTGAAAAATTTCGATTCCAATAATTTTCAGCGATGCAAACTACTCCTTGAATGAATAATGAATTTTGAACAAAGAAGTGGAGGATAGATGACTTTCTGCAGTTTGCACCGAGCGAAATT
GAAACTGACATGTTTACGGTGAATTTTACTTGGAGGGCTGTGACGCCTCCGTCATCATCGCGTCCCGCGACAACGACGCCGAGAAGGACGCGCCGGGCAACGTGTCCCTCGCCGGCGACG
GCTTCGACACCGTGGTGCGCGCCAAGGCCGAGGTCGAGAAGGCGTGCCCTGGCGTGGTCTCCTGCGCCGACATCCTCGCCATCGCCGCCAGGGACGTCGTCACCATGGTA
ACCGCAAGAG
CTCTCGCTTCCTGAGCGTTACGATGGCAATGTCGGTGTCTGATACCGTGGTTGTCCAATGGCACGTGGCAGTCTTCCGGCCCGCACTGGCCCGTCGAGCTCGGCCGGCTGGACGGTCTCG
TCTCCAAGGCCGGCAGCGTCGCGGGCAGGCTGCCGGGGCCGGACATGCGCGTCGACGACCTCGCCGCCCTGTTCGCCAAGCACAACCTCACCACGCTCGACATGGTCGCGCTCTCGGGCG
CGCACACCGTCGGGTTCGCGCACTGCACCCGCTTCACGGGCCGCCTCTACNNNCGC
CANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTCGGTGGACCCGTCGTACGACCCCGCGT
ACGCGCGGCAGCTCATGGAGGCGTGCCCGCCGGACGTCGGCGCGACCATCGCCGTCGACATGGACCCGGTCACCCCGACCGCCTTCGACAACGCCTACTACGGCAACCTCGCCGGCGGGA
TGGGCCTGTTCACCTCCGACCAGGCGCTGTACAGCGACGGCGCGTCGCGGCCGGCGGTCGGGGACTTCGCCAAGAACCAGACGCGCTTCTTCGAGGCGTTCAAGGACGCCATGGTCAAGC
TGGGCAGAGTTGGGGTGAAGACCGGCAGGCATGGGGAGATCAGGAGAGACTGCACCGCGTTCAACAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGAGATGGAGAAAACGCGGGAGCTTGCTCGCCGTCGCAGCCGTGGCCCTGGTGGCAGCATTGCTGCCGTCCGGCGAGGCGAAGCTGTCCCCGGACTACTACCGGTCGACGTGCCCGGAC
GTCGAGGCGATCGTGCGGGAGGCGGTGGCCAAGAAGGTCAACGAGACCTTCGTCACTGTCCCAGCCACGCTCAGGCTCTTCTTCCACGACTGCTTCGTCGAGGTG
TGTGACGCCTCCGTC
ATCATCGCGTCCCGCGACAACGACGCCGAGAAGGACGCGCCGGGCAACGTGTCCCTCGCCGGCGACGGCTTCGACACCGTGGTGCGCGCCAAGGCCGAGGTCGAGAAGGCGTGCCCTGGC
GTGGTCTCCTGCGCCGACATCCTCGCCATCGCCGCCAGGGACGTCGTCACCATGGTA
TCCGGCCCGCACTGGCCCGTCGAGCTCGGCCGGCTGGACGGTCTCGTCTCCAAGGCCGGCAGC
GTCGCGGGCAGGCTGCCGGGGCCGGACATGCGCGTCGACGACCTCGCCGCCCTGTTCGCCAAGCACAACCTCACCACGCTCGACATGGTCGCGCTCTCGGGCGCGCACACCGTCGGGTTC
GCGCACTGCACCCGCTTCACGGGCCGCCTCTACNNNCGC
NNNNNNNNNNCGTCGGTGGACCCGTCGTACGACCCCGCGTACGCGCGGCAGCTCATGGAGGCGTGCCCGCCGGACGTCGGC
GCGACCATCGCCGTCGACATGGACCCGGTCACCCCGACCGCCTTCGACAACGCCTACTACGGCAACCTCGCCGGCGGGATGGGCCTGTTCACCTCCGACCAGGCGCTGTACAGCGACGGC
GCGTCGCGGCCGGCGGTCGGGGACTTCGCCAAGAACCAGACGCGCTTCTTCGAGGCGTTCAAGGACGCCATGGTCAAGCTGGGCAGAGTTGGGGTGAAGACCGGCAGGCATGGGGAGATC
AGGAGAGACTGCACCGCGTTCAACAAGTAG

Retrieve as FASTA