Entry information : SiPrx127 (Si030541m)
Entry ID 9472
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx127 (Si030541m)
Name (synonym) SiPrx127 (Si030541m)
Class Class III peroxidase    [Orthogroup: Prx082]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx127
start..stop
S start..stop
ZmPrx56 550 0 6..321 11..323
SbPrx49 519 0 2..321 9..323
OsPrx115 512 0 24..321 23..321
BdiPrx04 484 2e-174 1..322 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48203181..48203390 210 N° 2 48202892..48203086 195 N° 3 48201944..48202507 564  
complement(join(48201944..48202507,48202892..48203086,48203181..48203390))


exon

Literature and cross-references SiPrx127 (Si030541m)
DNA ref. Phytozome 12:   scaffold_2 (48203390..48201944)
Protein sequence: SiPrx127 (Si030541m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (305)
PWM (Da):   %s   34519.78 (32670.8) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.23 (4.23) Peptide Signal:   %s   cut: 18 range:18-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATVLVYLTVMAAVVASAAFGAAELTADYYSETCPHALSTIKLLVGAAILREPRMGASLVRLHFHDCFVNGCDGSILLDDTDDMIGEKTAKPNNNSIRGYDVIDTIKSAVNTVCLGNVVSCADIVAVAARDSIVALGGTSYDVLLGRRDATTASIDDANNDIPNPFMDLPALVSNFESHGLSLHDLVVLSGGHTLGYSRCLFFRSRLYNETDTLDPAYAASLDERCPPSGDDEALTSLDDTPTTVDTDYYQGLMQGRALLHSDQQLYQGGGGDADALVKYYGEKPSKFWEDFAAAMVKMGNLSPLTGDEGEIRENCRVVNQE*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCGTTCTTGTTTACCTCACCGTGATGGCGGCGGTTGTGGCCTCGGCGGCGTTCGGGGCGGCGGAGCTCACCGCGGATTACTACAGCGAGACGTGCCCGCACGCGCTGAGCACC
ATCAAGCTCCTCGTCGGCGCGGCCATCCTCAGGGAGCCCAGGATGGGGGCGTCGCTCGTCCGCCTCCACTTCCACGACTGCTTCGTCAAT
GTGAGTAGCTGTCTTCTACTACCTAGCGGC
TGATCAGGCCACGCCACCATGTGCATGCCGAGCTACTAACTTGTTCTGAAAAATGTTGTTGCAGGGCTGCGACGGCTCCATCCTGCTGGACGACACCGATGACATGATCGGCGAGAAGAC
GGCCAAGCCCAACAACAACTCGATCAGAGGGTACGACGTCATCGACACCATCAAGTCGGCGGTGAACACGGTCTGCTTGGGGAACGTCGTCTCCTGCGCTGACATCGTGGCTGTAGCTGC
TCGAGACTCCATTGTCGCG
GTAAGTTCGATCAGCTGGATGCTTATCCATTACTACTCATTGCACAAAGTGTCAAATGTTGATTGAGACTACACTGGCTAGAAATAAAGTTACAAAAGAGC
ACTAAGAGTATGACGAGCAATAGTATGCATAAAGCACCTTTGGATATGTGGTAATCTCTTCAACCTAACCCCATTAAGCCTGCCGTGACAAGAACACCATTTCTGGAAGAAAACAAACTG
CCTTTCTATAAATGTGCATTTTTTCAGCCACTTGCAGCATCCTTTTGAACCAGAGAAATTCAGGCATACTAATGATCGAATTTTCACCCTCCGCACTGACAGTGACATCACCTAGTATAA
TTTATAATTTGGTCTGCACGTACGTATAAATGGTTGTGTGCAGCTGGGAGGAACATCCTACGACGTGCTCCTGGGGCGGCGCGACGCGACGACGGCGAGCATCGACGACGCGAACAACGA
CATCCCGAACCCGTTCATGGACCTGCCGGCACTAGTCTCCAACTTCGAGTCCCACGGCCTCTCCCTGCACGACCTCGTCGTGCTCTCCGGCGGCCACACGCTGGGCTACTCCCGCTGCCT
CTTCTTCCGGAGCCGCCTCTACAACGAGACCGACACGCTGGACCCGGCCTACGCGGCGTCGCTGGACGAGCGGTGCCCGCCCTCCGGCGACGACGAGGCGCTGACGTCGCTGGACGACAC
CCCCACCACCGTCGACACCGATTACTACCAGGGCCTCATGCAGGGCCGCGCGCTGCTCCACTCGGACCAGCAGCTGTACCAGGGCGGCGGCGGCGACGCCGACGCCCTCGTCAAGTACTA
CGGCGAGAAGCCCAGCAAGTTCTGGGAGGACTTCGCCGCGGCCATGGTGAAGATGGGCAACCTCAGCCCGCTCACCGGCGACGAAGGCGAGATCAGGGAGAACTGCCGGGTCGTCAACCA
GGAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCGTTCTTGTTTACCTCACCGTGATGGCGGCGGTTGTGGCCTCGGCGGCGTTCGGGGCGGCGGAGCTCACCGCGGATTACTACAGCGAGACGTGCCCGCACGCGCTGAGCACC
ATCAAGCTCCTCGTCGGCGCGGCCATCCTCAGGGAGCCCAGGATGGGGGCGTCGCTCGTCCGCCTCCACTTCCACGACTGCTTCGTCAAT
GGCTGCGACGGCTCCATCCTGCTGGACGAC
ACCGATGACATGATCGGCGAGAAGACGGCCAAGCCCAACAACAACTCGATCAGAGGGTACGACGTCATCGACACCATCAAGTCGGCGGTGAACACGGTCTGCTTGGGGAACGTCGTCTCC
TGCGCTGACATCGTGGCTGTAGCTGCTCGAGACTCCATTGTCGCG
CTGGGAGGAACATCCTACGACGTGCTCCTGGGGCGGCGCGACGCGACGACGGCGAGCATCGACGACGCGAACAAC
GACATCCCGAACCCGTTCATGGACCTGCCGGCACTAGTCTCCAACTTCGAGTCCCACGGCCTCTCCCTGCACGACCTCGTCGTGCTCTCCGGCGGCCACACGCTGGGCTACTCCCGCTGC
CTCTTCTTCCGGAGCCGCCTCTACAACGAGACCGACACGCTGGACCCGGCCTACGCGGCGTCGCTGGACGAGCGGTGCCCGCCCTCCGGCGACGACGAGGCGCTGACGTCGCTGGACGAC
ACCCCCACCACCGTCGACACCGATTACTACCAGGGCCTCATGCAGGGCCGCGCGCTGCTCCACTCGGACCAGCAGCTGTACCAGGGCGGCGGCGGCGACGCCGACGCCCTCGTCAAGTAC
TACGGCGAGAAGCCCAGCAAGTTCTGGGAGGACTTCGCCGCGGCCATGGTGAAGATGGGCAACCTCAGCCCGCTCACCGGCGACGAAGGCGAGATCAGGGAGAACTGCCGGGTCGTCAAC
CAGGAGTGA

Retrieve as FASTA