Entry information : SiPrx132 (Si030601m)
Entry ID 9477
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx132 (Si030601m)
Name (synonym) SiPrx132 (Si030601m)
Class Class III peroxidase    [Orthogroup: Prx203]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx132
start..stop
S start..stop
HvPrx17 446 1e-159 2..310 3..312
OsPrx114 442 5e-158 1..310 1..310
TaPrx113-1A 440 4e-157 2..310 3..311
AvePrx113-1A 440 4e-157 2..310 3..311
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48198487..48198690 204 N° 2 48198870..48199043 174 N° 3 48199134..48199302 169 N° 4 48199386..48199774 389
join(48198487..48198690,48198870..48199043,48199134..48199302,48199386..48199774 )


exon

Literature and cross-references SiPrx132 (Si030601m)
DNA ref. Phytozome 12:   scaffold_2 (48198487..48199774)
Protein sequence: SiPrx132 (Si030601m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (290)
PWM (Da):   %s   32432.16 (30389.1)  
PI (pH):   %s   7.38 (7.41) Peptide Signal:   %s   cut: 22 range:22-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASCLSLLVLVALASSASAQLSSTFYDRSCPRALATIKSAVNAAVSQEARMGASLLRLHFHDCFVQGCDASVLLAGNEQNDPPNLTLRGFNVIANIKAQVEAICKQTVSCADILAVAARDSVVALGGPSWTVPLGRRDSLKAASTSMVLQNLIPPTSSLTQLIQGYGNLGLNPTDLVALSGAHTIGQAHCPSYQDHIYNDTNINQAFAASLKANCPATGGSNVMAPLDTTTPNAFDNAYFKNLQSQKGLLHSDQELFNGGSTDNTVRNFASNPSAFSSAFVTAMIKMGNISPLTGTQGQIRTTCSAANP*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTGCCTCTTGCCTTAGCCTGTTGGTGCTGGTGGCTCTGGCCTCGTCGGCGTCGGCGCAGCTGTCGTCGACGTTCTACGACAGGTCGTGCCCCAGGGCTCTGGCCACCATCAAG
AGCGCGGTGAATGCCGCGGTGTCGCAGGAGGCGCGCATGGGCGCCTCCCTGCTCAGGCTGCACTTCCACGACTGCTTTGTCCAA
GCAAGTGTCCACTGCACACCTAGTTATATTATTTTC
TAAGACAGTTCCGAGCTGTCAATCATCTTATGAATTACTTAATCTTACGTTAAAATAGCAAAATGTCCACAGTGACGTTTTGTGTACAGCATGAAACTACTGTAAGTCTGACTAATTGTC
ATGCTCTCTTTGACTCCGTGCAGGGTTGTGACGCATCCGTTCTGCTGGCGGGGAACGAGCAGAACGATCCTCCGAATCTAACTCTGAGAGGCTTCAACGTCATCGCCAACATCAAGGCGC
AGGTGGAGGCCATCTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTAGCG
GTAAGCCTATGAGCATGGTTCTCCTCCATCGACAGCTTGTTAC
GAGTTGTACCTTAACTGATAGCTGATTTGGTTTTGAGCGTTTGGCAGCTGGGAGGGCCGTCTTGGACAGTTCCGCTGGGGAGAAGGGACTCGCTGAAAGCTGCAAGCACGAGCATGGTGT
TGCAGAACCTCATCCCGCCTACATCTAGCCTCACTCAACTGATTCAAGGGTACGGGAACTTGGGCCTCAACCCAACCGACTTGGTTGCTCTCTCAG
GTACGCACACCCGTGCTCTCCTGT
TCTTATCGCAAGTCCTCTGTGATGATTTTAACATGTTTCCAATGAGTGGATTGTTGCAGGTGCGCACACGATCGGCCAGGCGCACTGCCCGAGCTACCAAGACCACATCTACAACGACAC
CAACATCAACCAGGCGTTCGCGGCGTCGCTCAAGGCCAACTGCCCCGCGACAGGCGGCTCCAACGTCATGGCACCGCTGGACACGACGACGCCCAACGCGTTCGACAACGCCTACTTCAA
GAACCTGCAGTCGCAGAAGGGGCTCCTGCACTCCGACCAGGAGCTCTTCAACGGCGGCAGCACCGACAACACGGTCCGCAACTTCGCGTCCAACCCGTCGGCGTTCAGCAGCGCCTTCGT
GACTGCCATGATCAAGATGGGCAACATCAGCCCTCTGACGGGGACGCAAGGCCAGATCAGGACCACATGCTCCGCGGCGAACCCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTGCCTCTTGCCTTAGCCTGTTGGTGCTGGTGGCTCTGGCCTCGTCGGCGTCGGCGCAGCTGTCGTCGACGTTCTACGACAGGTCGTGCCCCAGGGCTCTGGCCACCATCAAG
AGCGCGGTGAATGCCGCGGTGTCGCAGGAGGCGCGCATGGGCGCCTCCCTGCTCAGGCTGCACTTCCACGACTGCTTTGTCCAA
GGTTGTGACGCATCCGTTCTGCTGGCGGGGAACGAG
CAGAACGATCCTCCGAATCTAACTCTGAGAGGCTTCAACGTCATCGCCAACATCAAGGCGCAGGTGGAGGCCATCTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCC
CGCGACTCCGTCGTAGCG
CTGGGAGGGCCGTCTTGGACAGTTCCGCTGGGGAGAAGGGACTCGCTGAAAGCTGCAAGCACGAGCATGGTGTTGCAGAACCTCATCCCGCCTACATCTAGC
CTCACTCAACTGATTCAAGGGTACGGGAACTTGGGCCTCAACCCAACCGACTTGGTTGCTCTCTCAG
GTGCGCACACGATCGGCCAGGCGCACTGCCCGAGCTACCAAGACCACATCTAC
AACGACACCAACATCAACCAGGCGTTCGCGGCGTCGCTCAAGGCCAACTGCCCCGCGACAGGCGGCTCCAACGTCATGGCACCGCTGGACACGACGACGCCCAACGCGTTCGACAACGCC
TACTTCAAGAACCTGCAGTCGCAGAAGGGGCTCCTGCACTCCGACCAGGAGCTCTTCAACGGCGGCAGCACCGACAACACGGTCCGCAACTTCGCGTCCAACCCGTCGGCGTTCAGCAGC
GCCTTCGTGACTGCCATGATCAAGATGGGCAACATCAGCCCTCTGACGGGGACGCAAGGCCAGATCAGGACCACATGCTCCGCGGCGAACCCGTAA

Retrieve as FASTA