Entry information : SiPrx134 (Si030855m)
Entry ID 9478
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-12 (Qiang Li)
Peroxidase information: SiPrx134 (Si030855m)
Name (synonym) SiPrx134 (Si030855m)
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx134
start..stop
S start..stop
SbPrx[P]38 524 0 51..353 160..458
ZmPrx97 491 4e-176 8..352 7..349
SbPrx37 491 1e-175 8..352 8..364
ZmPrx30 491 2e-175 51..353 86..391
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46709330..46709479 150 N° 2 46708386..46708526 141 N° 3 46707505..46708275 771  
complement(join(46707505..46708275,46708386..46708526,46709330..46709479))


exon

Literature and cross-references SiPrx134 (Si030855m)
DNA ref. Phytozome 12:   scaffold_2 (46709479..46707505)
Protein sequence: SiPrx134 (Si030855m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (332)
PWM (Da):   %s   38146.88 (36110.7)  
PI (pH):   %s   6.16 (6.17) Peptide Signal:   %s   cut: 22 range:22-353
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAVTLPAILTVLALLGSVACQGGYGDGNPAPAPRPDAYPPVRPRPPPSPKLKIGYYKNKCDHHVDVEAIVRKHVGSFNDGMKAGLIRLFFHDCFTRGCDASILLDPTSDNQQPEKFGIPNFPSMRGYEVIDAAKAELEAKCPGKVSCADIVAFAARDASYFLSGGGINFDMPAGRYDGNVSLASETLPNLPPPFAGLQQLEKMFADKGLDSFDMVTLSGAHSIGRSHCSSFSRDRLPPSATSDMDPAFAAGLQANCSSANGADNTVVEDHETPDVLDNQYYQNVLDRKVLFTSDAALTSKDMTNNLVRVYAIFPWLWQQKFEEAMVKMSRIEVKTAATGEIRRTCRAVNSKP*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCCGTTACGCTCCCTGCCATCCTCACAGTGCTCGCTTTGCTCGGTTCCGTCGCATGCCAAGGCGGCTACGGAGACGGCAACCCAGCGCCAGCGCCACGACCGGACGCTTACCCG
CCGGTCAGACCACGGCCGCCTCCTTCCCCT
CCGACCACCTCACGGCCACCTTCATATCCTACGACGAGTCTAAATCCACCGCCACCCCCCAAGATCCCGCAACCACTCACTTATCCTCGT
GGTAATTCCAATTCACCACCACCTAAACCTTGCGGCCACTGACCTATCGTCGAGCTATTGCCAGCCCGCACCCACCTAACACCCCCTGAGCACCAGGGACTCCTCATGCAAACCCAAGTT
CATCGACCCCTACGCAAACACCATCACATACTTATTCTCCAAGTTGGTCGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCCACAGCCCACCAATTTTTACACTCCTTATGAGTTCC
GAGCCTGAGTCCTCCACTCCCTAAAGCCATCCCAGCCACCCGCCTATCGTCCCTCCGAGTCCGGACCCACAGCCCACCTAAAGCCCTCAAAGCTACCCCACCTTATCCCTCCGACAAAGT
CCGGACCCACCCACCACCTAAAGGCCTCACAGCCACCCACCTATCCTCCGACAAGTCCGAGCCCACCACCACCTATTCTCACACCCCCACCCAGTCCAGGTGATGCTGAGAAGAAACTCA
AGATCGGATACTACAAGAACAAATGTGATCATCACGTGGATGTGGAGGCTATCGTAAGGAAACATGTCGGAAGCTTCAACGATGGCATGAAAGCAGGGCTTATCCGCCTCTTCTTTCACG
ACTGCTTTACCCGG
GTAAGATCTCGATCAAGCTAGACATCGGTTGCAATATTATGTATTACTGGTAGTAAATACATGCTTATGTTCATAAGTACTCAATTGCATTTTGATGCGCGGTGGT
TCAGGGTTGCGATGCGTCCATTCTGCTCGATCCAACCAGCGACAACCAGCAGCCGGAGAAGTTCGGCATACCCAACTTCCCGAGCATGCGCGGCTACGAGGTGATCGACGCCGCCAAGGC
GGAGCTCGAGGCGAAATGCCCCGGCAAGGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCGTCCTACTTCCTCAGCGGCGGCGGCATCAACTTCGACATGCCCGCGGGCCG
CTACGACGGCAACGTGTCCCTGGCCAGCGAGACCCTCCCCAACCTGCCGCCGCCGTTCGCCGGCCTCCAGCAGCTTGAGAAGATGTTCGCCGACAAAGGGCTCGACAGCTTCGACATGGT
GACGCTCTCCGGCGCGCACAGCATCGGGCGCTCCCACTGCTCGTCCTTCAGCCGCGACCGCCTCCCTCCCAGCGCCACCTCCGACATGGACCCGGCGTTCGCCGCCGGGCTGCAGGCTAA
CTGCTCGTCGGCGAACGGCGCCGACAACACGGTGGTGGAGGACCACGAGACCCCCGACGTCCTGGACAACCAGTACTACCAGAACGTGCTCGACCGCAAGGTCCTCTTCACGTCGGACGC
CGCGCTCACCTCCAAGGACATGACCAACAACCTGGTGCGTGTCTACGCGATCTTTCCGTGGCTGTGGCAGCAGAAGTTCGAAGAAGCCATGGTGAAGATGAGCCGCATCGAGGTCAAGAC
AGCCGCCACCGGGGAGATCAGGAGGACGTGCCGCGCCGTCAACAGCAAGCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCCGTTACGCTCCCTGCCATCCTCACAGTGCTCGCTTTGCTCGGTTCCGTCGCATGCCAAGGCGGCTACGGAGACGGCAACCCAGCGCCAGCGCCACGACCGGACGCTTACCCG
CCGGTCAGACCACGGCCGCCTCCTTCCCCT
AAACTCAAGATCGGATACTACAAGAACAAATGTGATCATCACGTGGATGTGGAGGCTATCGTAAGGAAACATGTCGGAAGCTTCAACGAT
GGCATGAAAGCAGGGCTTATCCGCCTCTTCTTTCACGACTGCTTTACCCGG
GGTTGCGATGCGTCCATTCTGCTCGATCCAACCAGCGACAACCAGCAGCCGGAGAAGTTCGGCATACCC
AACTTCCCGAGCATGCGCGGCTACGAGGTGATCGACGCCGCCAAGGCGGAGCTCGAGGCGAAATGCCCCGGCAAGGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCGTCC
TACTTCCTCAGCGGCGGCGGCATCAACTTCGACATGCCCGCGGGCCGCTACGACGGCAACGTGTCCCTGGCCAGCGAGACCCTCCCCAACCTGCCGCCGCCGTTCGCCGGCCTCCAGCAG
CTTGAGAAGATGTTCGCCGACAAAGGGCTCGACAGCTTCGACATGGTGACGCTCTCCGGCGCGCACAGCATCGGGCGCTCCCACTGCTCGTCCTTCAGCCGCGACCGCCTCCCTCCCAGC
GCCACCTCCGACATGGACCCGGCGTTCGCCGCCGGGCTGCAGGCTAACTGCTCGTCGGCGAACGGCGCCGACAACACGGTGGTGGAGGACCACGAGACCCCCGACGTCCTGGACAACCAG
TACTACCAGAACGTGCTCGACCGCAAGGTCCTCTTCACGTCGGACGCCGCGCTCACCTCCAAGGACATGACCAACAACCTGGTGCGTGTCTACGCGATCTTTCCGTGGCTGTGGCAGCAG
AAGTTCGAAGAAGCCATGGTGAAGATGAGCCGCATCGAGGTCAAGACAGCCGCCACCGGGGAGATCAGGAGGACGTGCCGCGCCGTCAACAGCAAGCCGTGA

Retrieve as FASTA