Entry information : SiPrx14 (Si002124m)
Entry ID 9481
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx14 (Si002124m)
Name (synonym) SiPrx14 (Si002124m)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx14
start..stop
S start..stop
SiPrx15 630 0 1..338 1..338
SiPrx17 601 0 1..337 1..334
SbPrx54 601 0 1..337 1..334
SbPrx53 601 0 1..338 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4686637..4686873 237 N° 2 4685824..4686015 192 N° 3 4685165..4685749 585  
complement(join(4685165..4685749,4685824..4686015,4686637..4686873))


exon

Literature and cross-references SiPrx14 (Si002124m)
DNA ref. Phytozome 12:   scaffold_5 (4686873..4685165)
Protein sequence: SiPrx14 (Si002124m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339
PWM (Da):   %s   36357.42 Transmb domain:   %s   i9-31o
PI (pH):   %s   7.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASMDGRLVLLTCLLVAPLLLAGGVHGHPWGGLFPQFYDHSCPQAKEIVKSIVAQAVARETRMAASLVRLHFHDCFVQGCDASILLDNSTGIVSEKGSNPNRNSARGFEVIDEIKVALEHACPGTVSCADILALAARDSTLLVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFRRQGLDVVDVVALSGAHTIGLSRCTSFRQRLYNQTGNGMADFTLDASYAAHLRQGCPRSGGDDNLFPLDLATPTKFDNYYFKNLLVGKGLLSSDEVLLTKSAETAALVKAYAADVNFFFQHFAQSMVKMGNVSPLTGAQGEVRKNCRRLNGNHY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCATGGATGGTCGCCTCGTCCTCCTCACCTGCCTCCTCGTCGCTCCCCTCCTCCTCGCCGGCGGCGTCCATGGCCACCCGTGGGGCGGCCTGTTCCCGCAGTTCTACGAC
CACTCGTGCCCCCAGGCGAAGGAGATCGTGAAGTCCATCGTGGCGCAGGCCGTCGCCAGGGAGACTAGGATGGCGGCCTCGCTCGTCAGGCTGCATTTCCATGACTGCTTTGTCCAG
GTT
GCTACTGCTTTCCTAGCTCTTTGCTACTGTATCTTATTGTTTGCATGTTTTGCACTATTGTGACGCCTGATAAACTTGTAGTTCCCGAAGCGCACTATAGCTAATCAGCAACGTTTCGTA
CCATAAAGTTTTGGCTTCTGTGTTTAGTACAATGGAACTGTACGTGATCCGTACAAAATTATTTTGAAATCCAAACAAACATATGATGAAGCACTAAAAATTCAATGATTATTGTGCCTA
TTTACCAACTTCATCTGCATAAACACATCACTTAAAGTGCAGTCTACAACTCCAACTTTTTTTCTATATATGTGCGTAGGTATTGGAAAAGTCAGCATGGAAGAATCTGCAGTTCCTAGG
CTAACTTTTCTTTTACCGTACCAGTGATAAGATAGCCTACCTACATTTCCAAGAGGAGCACGCCACTTTATTTGTACCATGGTTCATCAATCCTTCGTTTATTTAATTATCTACTATGAA
AAAAATATGACTACACAATAATTGACAGCCTCCACATGTGTGAAATTTTGATATTCCATTCAAGGCATGTTTCTAATGACTCTCATGCGCCTAATCTAACTAGTAATCTTCTCTGTCACT
ATCTTTCTCTGTGTGCAGGGATGCGACGCCTCTATACTGCTGGACAACAGCACCGGCATCGTGAGCGAGAAAGGGTCCAACCCCAACAGGAACTCCGCCAGAGGATTCGAGGTGATCGAC
GAGATCAAGGTCGCCCTGGAGCACGCCTGCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACTCCACCCTCCTT
GTAAGCAGCAGAAACGACCGCGATTATTAT
ATATATTCTTAGTGATCTCAACTAGCTACTGACCCCGGCCGCAGGTTGGCGGCCCCTACTGGGACGTGCCGCTGGGGCGGCGGGACTCGCTGGGCGCCAGCATCCAGGGCTCCAACAACG
ACATCCCGGCGCCCAACAACACCCTCCCCACCATCATCACCAAGTTCCGGCGCCAGGGCCTCGACGTCGTCGACGTCGTCGCGCTCTCCGGCGCCCACACCATCGGCCTCTCCCGCTGCA
CCAGCTTCCGGCAGCGGCTGTACAACCAGACGGGCAACGGCATGGCCGACTTCACGCTGGACGCCTCCTACGCCGCGCACCTGAGGCAGGGCTGCCCGCGCTCCGGCGGCGACGACAACC
TCTTCCCGCTGGACCTCGCCACCCCCACCAAGTTCGACAACTATTACTTCAAGAACCTCCTCGTCGGCAAGGGCCTGCTCAGCTCCGACGAGGTCCTGCTGACGAAGAGCGCCGAGACGG
CGGCGCTCGTCAAGGCCTACGCCGCCGACGTCAACTTCTTCTTCCAGCACTTCGCGCAGTCGATGGTGAAGATGGGCAACGTCTCGCCGCTCACCGGGGCGCAGGGGGAGGTCAGGAAGA
ACTGCAGGAGGCTCAACGGCAACCACTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCATGGATGGTCGCCTCGTCCTCCTCACCTGCCTCCTCGTCGCTCCCCTCCTCCTCGCCGGCGGCGTCCATGGCCACCCGTGGGGCGGCCTGTTCCCGCAGTTCTACGAC
CACTCGTGCCCCCAGGCGAAGGAGATCGTGAAGTCCATCGTGGCGCAGGCCGTCGCCAGGGAGACTAGGATGGCGGCCTCGCTCGTCAGGCTGCATTTCCATGACTGCTTTGTCCAG
GGA
TGCGACGCCTCTATACTGCTGGACAACAGCACCGGCATCGTGAGCGAGAAAGGGTCCAACCCCAACAGGAACTCCGCCAGAGGATTCGAGGTGATCGACGAGATCAAGGTCGCCCTGGAG
CACGCCTGCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACTCCACCCTCCTT
GTTGGCGGCCCCTACTGGGACGTGCCGCTGGGGCGGCGGGACTCGCTGGGC
GCCAGCATCCAGGGCTCCAACAACGACATCCCGGCGCCCAACAACACCCTCCCCACCATCATCACCAAGTTCCGGCGCCAGGGCCTCGACGTCGTCGACGTCGTCGCGCTCTCCGGCGCC
CACACCATCGGCCTCTCCCGCTGCACCAGCTTCCGGCAGCGGCTGTACAACCAGACGGGCAACGGCATGGCCGACTTCACGCTGGACGCCTCCTACGCCGCGCACCTGAGGCAGGGCTGC
CCGCGCTCCGGCGGCGACGACAACCTCTTCCCGCTGGACCTCGCCACCCCCACCAAGTTCGACAACTATTACTTCAAGAACCTCCTCGTCGGCAAGGGCCTGCTCAGCTCCGACGAGGTC
CTGCTGACGAAGAGCGCCGAGACGGCGGCGCTCGTCAAGGCCTACGCCGCCGACGTCAACTTCTTCTTCCAGCACTTCGCGCAGTCGATGGTGAAGATGGGCAACGTCTCGCCGCTCACC
GGGGCGCAGGGGGAGGTCAGGAAGAACTGCAGGAGGCTCAACGGCAACCACTAC

Retrieve as FASTA