Entry information : SiPrx140 (Si032029m)
Entry ID 9482
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx140 (Si032029m)
Name (synonym) SiPrx140 (Si032029m)
Class Class III peroxidase    [Orthogroup: Prx143]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx140
start..stop
S start..stop
SiPrx141 543 0 1..345 1..360
SiPrx176 511 0 44..345 48..350
SiPrx138 511 0 44..345 48..350
SbPrx44 505 0 17..345 24..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46740948..46741217 270 N° 2 46741337..46742101 765  
join(46740948..46741217,46741337..46742101)


exon

Literature and cross-references SiPrx140 (Si032029m)
DNA ref. Phytozome 12:   scaffold_2 (46740948..46742101)
Protein sequence: SiPrx140 (Si032029m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (325)
PWM (Da):   %s   36151.19 (34013.9)  
PI (pH):   %s   5.77 (5.11) Peptide Signal:   %s   cut: 21 range:21-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLAVLALLVLLGSVTCRADYGYGGYPSPTPTPTPTPPPSAGGLTVGFYDSTCPNAEDIVRGVVEKAVTQDPGVGAGLIRMLFHDCFVQGCDASVLLDPTTANPQPEKLSPPNFPSLRGFEVIDAAKAALEAACPGNVSCADIVAFAGRDASVVLSGRRINFTMPAGRRDGRVSNSSDALQFLPPPSFNLSELTASFAAKGLDVDDLVVLSGAHTVGRSHCSSFVTDGRLNASTSDMNPGLAASLRQECPASPNATNDPTVAQDVVTPVTLDNQYYKNVLNRSVLFTSDAALLNSGQTAVSVLLNAVTPGRWEQMFAKAMVKMARIEVKTGTNGEIRRSCRIVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGCTTGCAGTTCTGGCCTTGCTTGTGTTGCTCGGTTCGGTGACATGCCGAGCCGACTACGGCTACGGTGGTTACCCCAGCCCAACACCGACACCAACCCCCACCCCGCCACCG
AGCGCCGGCGGCCTCACCGTCGGCTTCTACGACAGCACGTGCCCAAACGCCGAGGACATCGTGAGGGGTGTAGTCGAGAAGGCGGTGACACAGGACCCTGGCGTTGGCGCGGGGCTCATT
AGGATGCTCTTCCACGACTGCTTCGTGCAG
GTACGACGACGCATGCATGTGTTGGGACTTCTTCAGTTTAGGGTGGCGCTCATCATTGTGTATGCTTGCACGCGCGCGCACATGTGCTTA
CTATACGCGCTGTGACTTGTGCCTGGCAGGGGTGCGACGCGTCCGTGCTGCTCGACCCGACCACGGCGAACCCGCAGCCTGAGAAGCTGTCCCCGCCGAACTTCCCGAGCCTGCGCGGCT
TCGAGGTCATCGACGCGGCCAAGGCGGCGCTCGAGGCCGCGTGCCCGGGCAACGTCTCCTGCGCCGACATCGTCGCCTTCGCCGGCCGCGACGCCAGCGTCGTCCTCAGCGGCCGCAGGA
TCAACTTCACGATGCCCGCGGGCCGCCGCGACGGCCGCGTGTCCAACTCCAGCGACGCGCTCCAGTTCCTGCCACCGCCCTCGTTCAACCTCTCCGAGCTCACCGCCAGCTTCGCCGCCA
AGGGTCTCGACGTCGACGACCTCGTCGTGCTCTCCGGCGCGCACACCGTCGGCCGCTCCCACTGCTCGTCCTTCGTCACCGACGGCCGCCTCAACGCGTCCACGTCCGACATGAACCCGG
GGCTGGCGGCGTCGCTGAGGCAGGAATGCCCGGCGAGCCCGAACGCGACCAACGACCCCACGGTGGCGCAGGACGTGGTGACGCCAGTCACGCTGGACAACCAGTACTACAAGAATGTGC
TCAACCGCAGCGTTCTGTTCACGTCGGACGCGGCGCTCCTCAACTCGGGGCAGACGGCGGTGTCCGTGCTGCTCAACGCGGTGACCCCTGGGCGTTGGGAGCAGATGTTCGCCAAGGCGA
TGGTGAAGATGGCTCGCATCGAGGTGAAGACAGGCACCAACGGCGAGATCAGGAGGAGCTGCAGGATCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGCTTGCAGTTCTGGCCTTGCTTGTGTTGCTCGGTTCGGTGACATGCCGAGCCGACTACGGCTACGGTGGTTACCCCAGCCCAACACCGACACCAACCCCCACCCCGCCACCG
AGCGCCGGCGGCCTCACCGTCGGCTTCTACGACAGCACGTGCCCAAACGCCGAGGACATCGTGAGGGGTGTAGTCGAGAAGGCGGTGACACAGGACCCTGGCGTTGGCGCGGGGCTCATT
AGGATGCTCTTCCACGACTGCTTCGTGCAG
GGGTGCGACGCGTCCGTGCTGCTCGACCCGACCACGGCGAACCCGCAGCCTGAGAAGCTGTCCCCGCCGAACTTCCCGAGCCTGCGCGGC
TTCGAGGTCATCGACGCGGCCAAGGCGGCGCTCGAGGCCGCGTGCCCGGGCAACGTCTCCTGCGCCGACATCGTCGCCTTCGCCGGCCGCGACGCCAGCGTCGTCCTCAGCGGCCGCAGG
ATCAACTTCACGATGCCCGCGGGCCGCCGCGACGGCCGCGTGTCCAACTCCAGCGACGCGCTCCAGTTCCTGCCACCGCCCTCGTTCAACCTCTCCGAGCTCACCGCCAGCTTCGCCGCC
AAGGGTCTCGACGTCGACGACCTCGTCGTGCTCTCCGGCGCGCACACCGTCGGCCGCTCCCACTGCTCGTCCTTCGTCACCGACGGCCGCCTCAACGCGTCCACGTCCGACATGAACCCG
GGGCTGGCGGCGTCGCTGAGGCAGGAATGCCCGGCGAGCCCGAACGCGACCAACGACCCCACGGTGGCGCAGGACGTGGTGACGCCAGTCACGCTGGACAACCAGTACTACAAGAATGTG
CTCAACCGCAGCGTTCTGTTCACGTCGGACGCGGCGCTCCTCAACTCGGGGCAGACGGCGGTGTCCGTGCTGCTCAACGCGGTGACCCCTGGGCGTTGGGAGCAGATGTTCGCCAAGGCG
ATGGTGAAGATGGCTCGCATCGAGGTGAAGACAGGCACCAACGGCGAGATCAGGAGGAGCTGCAGGATCGTCAAC

Retrieve as FASTA