Entry information : SiPrx141 (Si032112m)
Entry ID 9483
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx141 (Si032112m)
Name (synonym) SiPrx141 (Si032112m)
Class Class III peroxidase    [Orthogroup: Prx143]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx141
start..stop
S start..stop
SiPrx140 517 0 1..360 1..345
SiPrx176 491 4e-176 58..360 48..350
SiPrx138 491 4e-176 58..360 48..350
SbPrx44 469 3e-167 58..360 50..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46749312..46749623 312 N° 2 46749718..46750485 768  
join(46749312..46749623,46749718..46750485)


exon

Literature and cross-references SiPrx141 (Si032112m)
DNA ref. Phytozome 12:   scaffold_2 (46749312..46750485)
Protein sequence: SiPrx141 (Si032112m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (340)
PWM (Da):   %s   37897.05 (35803.8)  
PI (pH):   %s   6.24 (5.95) Peptide Signal:   %s   cut: 21 range:21-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLAVVALLVLLGSVVCQADYGNPGFGSGSGSGFHIPIQIPFPHRTPTPTPSPNAGGLAVGFYDSTCQNAEEIVRGVVENAVRQNPGIGAGLIRMLFHDCFVEGCDGSVLLDPTPANPQPEKLAVPPNFPSLRGFEVIDAAKAALEDACPGNVSCADILAFAARDASAVLSNGNINFTVPAGRRDGRVSNSSDALQFLPPPSFNLSELTASFAAKGLDVDDLVVLSGAHTVGRSHCSPSVSDGRLNASTSDMNPGLAAQLRRQCPANPNATNDPTVAQDVVTPVRLDNQYYRNVLNHSVLFTSDAVLLRSVQTTLAVVMNAFVPGMWEQKFSRAMVKMANIEVKTGANGEIRRNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGCTTGCCGTGGTGGCATTGCTGGTGTTGCTCGGTTCAGTGGTGTGCCAAGCCGACTACGGCAACCCCGGCTTCGGCTCTGGTTCAGGCTCCGGCTTCCACATCCCGATCCAA
ATCCCGTTCCCGCACCGGACCCCGACGCCGACGCCGAGCCCGAACGCCGGCGGCCTCGCCGTCGGCTTCTACGACAGCACGTGCCAAAACGCCGAGGAGATCGTGAGGGGCGTCGTCGAG
AACGCGGTCAGACAGAACCCTGGCATTGGCGCGGGGCTCATTCGTATGCTCTTCCACGACTGCTTCGTCGAG
GTAAGCTAGCTTACATGCGTTCGCCTGTTCGATCGATGTGGACGTGTT
CTTCAGTTGTGATCGTGTCAGCATACTGAGCTATACTGAACTATAGGGATGTGACGGCTCCGTGCTGCTCGACCCGACGCCGGCGAACCCGCAGCCGGAGAAGCTGGCGGTGCCGCCCAA
CTTCCCCAGCCTTCGCGGTTTCGAGGTGATCGACGCGGCCAAGGCGGCGCTCGAGGACGCGTGCCCCGGCAACGTCTCCTGCGCCGACATCCTCGCCTTCGCCGCCCGCGACGCCAGCGC
CGTCCTCAGCAACGGCAACATCAACTTCACGGTGCCCGCGGGCCGCCGCGACGGGCGCGTGTCCAACTCCAGCGACGCGCTCCAGTTCCTGCCCCCTCCGTCCTTCAACCTCTCCGAGCT
CACCGCCAGCTTCGCCGCCAAGGGGCTCGACGTCGACGACCTCGTCGTGCTCTCCGGCGCGCACACCGTCGGCCGCTCCCACTGCTCGCCCTCCGTCAGCGACGGCCGCCTCAACGCGTC
CACGTCCGACATGAACCCTGGGCTGGCCGCGCAGCTGAGGCGGCAGTGCCCGGCCAACCCGAACGCGACCAACGACCCCACGGTGGCGCAGGACGTGGTGACGCCGGTCAGGCTGGACAA
CCAGTACTACAGGAACGTGCTCAACCACAGCGTGCTCTTCACGTCGGACGCGGTGCTGCTCAGGTCGGTGCAGACGACGCTGGCGGTGGTCATGAACGCGTTCGTCCCCGGGATGTGGGA
GCAGAAGTTCTCCAGGGCGATGGTGAAGATGGCGAACATCGAGGTGAAGACCGGCGCCAATGGCGAGATCAGGAGGAACTGCCGGGTCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGCTTGCCGTGGTGGCATTGCTGGTGTTGCTCGGTTCAGTGGTGTGCCAAGCCGACTACGGCAACCCCGGCTTCGGCTCTGGTTCAGGCTCCGGCTTCCACATCCCGATCCAA
ATCCCGTTCCCGCACCGGACCCCGACGCCGACGCCGAGCCCGAACGCCGGCGGCCTCGCCGTCGGCTTCTACGACAGCACGTGCCAAAACGCCGAGGAGATCGTGAGGGGCGTCGTCGAG
AACGCGGTCAGACAGAACCCTGGCATTGGCGCGGGGCTCATTCGTATGCTCTTCCACGACTGCTTCGTCGAG
GGATGTGACGGCTCCGTGCTGCTCGACCCGACGCCGGCGAACCCGCAG
CCGGAGAAGCTGGCGGTGCCGCCCAACTTCCCCAGCCTTCGCGGTTTCGAGGTGATCGACGCGGCCAAGGCGGCGCTCGAGGACGCGTGCCCCGGCAACGTCTCCTGCGCCGACATCCTC
GCCTTCGCCGCCCGCGACGCCAGCGCCGTCCTCAGCAACGGCAACATCAACTTCACGGTGCCCGCGGGCCGCCGCGACGGGCGCGTGTCCAACTCCAGCGACGCGCTCCAGTTCCTGCCC
CCTCCGTCCTTCAACCTCTCCGAGCTCACCGCCAGCTTCGCCGCCAAGGGGCTCGACGTCGACGACCTCGTCGTGCTCTCCGGCGCGCACACCGTCGGCCGCTCCCACTGCTCGCCCTCC
GTCAGCGACGGCCGCCTCAACGCGTCCACGTCCGACATGAACCCTGGGCTGGCCGCGCAGCTGAGGCGGCAGTGCCCGGCCAACCCGAACGCGACCAACGACCCCACGGTGGCGCAGGAC
GTGGTGACGCCGGTCAGGCTGGACAACCAGTACTACAGGAACGTGCTCAACCACAGCGTGCTCTTCACGTCGGACGCGGTGCTGCTCAGGTCGGTGCAGACGACGCTGGCGGTGGTCATG
AACGCGTTCGTCCCCGGGATGTGGGAGCAGAAGTTCTCCAGGGCGATGGTGAAGATGGCGAACATCGAGGTGAAGACCGGCGCCAATGGCGAGATCAGGAGGAACTGCCGGGTCGTCAAC

Retrieve as FASTA