Entry information : SiPrx147 (Si036449m)
Entry ID 9489
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx147 (Si036449m)
Name (synonym) SiPrx147 (Si036449m)
Class Class III peroxidase    [Orthogroup: Prx069]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx147
start..stop
S start..stop
SiPrx149 570 0 1..341 1..342
SiPrx150 560 0 24..343 20..340
SiPrx152 525 0 24..341 24..336
ZmPrx31 514 0 25..342 27..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34303486..34303719 234 N° 2 34303795..34303989 195 N° 3 34304483..34304645 163 N° 4 34305158..34305594 437
join(34303486..34303719,34303795..34303989,34304483..34304645,34305158..34305594 )


exon

Literature and cross-references SiPrx147 (Si036449m)
DNA ref. Phytozome 11:   scaffold_9 (34303486..34305594)
Protein sequence: SiPrx147 (Si036449m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (312)
PWM (Da):   %s   36379.09 (33465.6) Transmb domain:   %s   i9-31o
PI (pH):   %s   5.37 (4.97) Peptide Signal:   %s   cut: 32 range:32-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSSTRPRAAAAVAGVLAAAVAALCLHGAAAQLCETYYDDTCPDAYNIVKQVLIDAHKSDVRIYASLIRLHFHDCFVQGCDGSLLLDGVPGVINSEKGAPPNNNSARGFPVVDKAKAALEGACPGVVSCADILALAAEISVELSGGPKWGVLLGRLDGTTADFNGASNLPAPFENLTVLQGKFKAVGLNDVDLVALSGAHTFGRVQCANIADAPADRLYNFSGTNRPDPTLDSAYRAFLSQRCPRNGNSMVLNDLDPTTPDIFDKNYYTNLEVNRGFLTSDQELKSSPQARGTTAPIVDQFARSQDAFFKSFAQSMINMGNIKPVTDPSVGEVRCNCRKVNDS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCCTCTACACGTCCTCGCGCAGCCGCCGCCGTCGCCGGCGTGCTAGCGGCGGCGGTGGCTGCATTGTGCCTCCACGGTGCGGCGGCGCAGCTGTGCGAGACCTACTACGACGAC
ACGTGCCCCGACGCCTATAACATCGTGAAGCAGGTGCTCATCGACGCCCACAAGTCCGACGTGCGCATCTACGCCAGCCTCATCCGCCTCCATTTCCACGACTGCTTCGTCCAG
GTACCT
GCTGCCTGCCGCTGCCGTCACCGGCCGCCATGGCCACGCATGCCAAGCTTCTGATGCATGTAAATGTAGGGCTGCGACGGGTCGCTGCTGCTGGACGGCGTGCCGGGGGTGATCAACTCG
GAGAAAGGCGCGCCGCCCAACAACAACTCTGCGCGGGGGTTCCCGGTGGTGGACAAAGCCAAGGCGGCGCTGGAGGGCGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTC
GCCGCGGAGATCTCCGTCGAGCTG
GTACGTATGTGCGGTGGCCCTATGACTATGAGGCGCATGATGCCATCATGCAAACAGAAAGGATCGTCCTGCTGCAAAACACAGGGCCCCACCCAT
CAACACAAGGATCCAATTAATCCATCGAGATACTGCAACTTCTAGCACTTCCCAAAAAAAAAAACATGAACCCTATGCACAAATTAAAACACAAGGATCCAATCCATCGAGATAATGCAA
CTTCTGCAATATAGAGCACTTGCAAAAAAAAACATATTGCACTTGTCCACCAACAATAATACCCTATGCACAAATTAAAGAATCTACATACGACAGGAACAAGAGCCTACATAGCAGCAG
GTGCGTGCAAACAAAAGGACGTTTGTCCTGCTGCAGAACGCGGGGCCCCACCCAATGTGTGCATTATTCGAACACGGAATAAATCCATCGATCGATAATACAACTACTGCTGGCTGTAAT
TAGTAATTTTTCGCTTCACTCTAATCTCCGTGCGCAGTCCGGCGGCCCAAAGTGGGGCGTTCTGCTGGGGAGGCTGGACGGCACGACGGCCGACTTCAACGGCGCATCCAACCTGCCGGC
GCCCTTCGAAAACCTCACCGTGCTCCAGGGAAAGTTCAAGGCCGTCGGCCTTAACGACGTCGACCTCGTCGCTCTCTCAG
GCACGAGCCCGCATCTTATCAGTTCCGGTTAATCAAACTC
ATTATCATTAATTAGTTACGACGTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCATCATTCATGACCTTTTCTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTCGGCTTTTCCTTGACGT
ACATGAACTATATGTACATAGTTGTCACATGAAACTTAATGCACAGTATACCAGATTGCTGTTCTCACCAACGACCCATCTGATGTTTCTATTGAATATAATGTGATCGCAGGGGCCCAC
ACATTTGGTAGGGTACAATGCGCAAACATAGCCGACGCCCCAGCTGACCGACTCTACAACTTCAGCGGGACGAACCGACCTGACCCGACCCTGGACTCGGCTTACCGAGCATTTCTATCC
CAGAGGTGCCCGAGAAATGGCAACAGCATGGTTCTCAACGATCTTGATCCAACAACACCAGATATCTTTGACAAGAACTACTACACGAATCTTGAAGTGAACCGGGGGTTCCTCACTTCC
GACCAGGAGCTCAAGTCCTCGCCCCAAGCACGGGGCACAACGGCACCGATCGTCGACCAGTTTGCGAGGAGCCAGGATGCTTTCTTCAAGAGTTTTGCACAGTCCATGATCAACATGGGG
AACATTAAGCCCGTGACTGACCCCTCCGTTGGAGAAGTCCGTTGCAACTGCAGAAAGGTTAACGACAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCCTCTACACGTCCTCGCGCAGCCGCCGCCGTCGCCGGCGTGCTAGCGGCGGCGGTGGCTGCATTGTGCCTCCACGGTGCGGCGGCGCAGCTGTGCGAGACCTACTACGACGAC
ACGTGCCCCGACGCCTATAACATCGTGAAGCAGGTGCTCATCGACGCCCACAAGTCCGACGTGCGCATCTACGCCAGCCTCATCCGCCTCCATTTCCACGACTGCTTCGTCCAG
GGCTGC
GACGGGTCGCTGCTGCTGGACGGCGTGCCGGGGGTGATCAACTCGGAGAAAGGCGCGCCGCCCAACAACAACTCTGCGCGGGGGTTCCCGGTGGTGGACAAAGCCAAGGCGGCGCTGGAG
GGCGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCGGAGATCTCCGTCGAGCTG
TCCGGCGGCCCAAAGTGGGGCGTTCTGCTGGGGAGGCTGGACGGCACGACG
GCCGACTTCAACGGCGCATCCAACCTGCCGGCGCCCTTCGAAAACCTCACCGTGCTCCAGGGAAAGTTCAAGGCCGTCGGCCTTAACGACGTCGACCTCGTCGCTCTCTCAG
GGGCCCAC
ACATTTGGTAGGGTACAATGCGCAAACATAGCCGACGCCCCAGCTGACCGACTCTACAACTTCAGCGGGACGAACCGACCTGACCCGACCCTGGACTCGGCTTACCGAGCATTTCTATCC
CAGAGGTGCCCGAGAAATGGCAACAGCATGGTTCTCAACGATCTTGATCCAACAACACCAGATATCTTTGACAAGAACTACTACACGAATCTTGAAGTGAACCGGGGGTTCCTCACTTCC
GACCAGGAGCTCAAGTCCTCGCCCCAAGCACGGGGCACAACGGCACCGATCGTCGACCAGTTTGCGAGGAGCCAGGATGCTTTCTTCAAGAGTTTTGCACAGTCCATGATCAACATGGGG
AACATTAAGCCCGTGACTGACCCCTCCGTTGGAGAAGTCCGTTGCAACTGCAGAAAGGTTAACGACAGT

Retrieve as FASTA