Entry information : SiPrx151 (Si036487m)
Entry ID 9494
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-12 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: SiPrx151 (Si036487m)
Name (synonym) SiPrx151 (Si036487m)
Class Class III peroxidase    [Orthogroup: Prx131]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx151
start..stop
S start..stop
SbPrx21 527 0 26..339 18..331
ZmPrx17 520 0 31..339 23..329
BdiPrx47 457 2e-163 29..339 25..328
OsPrx37 427 4e-151 33..339 28..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51865842..51866075 234 N° 2 51865547..51865738 192 N° 3 51865265..51865427 163 N° 4 51864711..51865141 431
complement(join(51864711..51865141,51865265..51865427,51865547..51865738,5186584 2..51866075))


exon

Literature and cross-references SiPrx151 (Si036487m)
DNA ref. Phytozome 12:   scaffold_9 (51866075..51864711)
Protein sequence: SiPrx151 (Si036487m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (309)
PWM (Da):   %s   35417.48 (32601.9) Transmb domain:   %s   i7-24o
PI (pH):   %s   4.69 (4.61) Peptide Signal:   %s   cut: 31 range:31-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARPAMLPAAAVALCAAVLALAALDGGVRAQQLSPGYYDDSCPHVYDTVRRVIQEARTGDPRILASLLRLHFHDCFASGCDGSLLLDETLTMRSEKAADPNNGSVRGFPVVNDIKAALEDACPGVVSCADILALAAEVSVELAGGPYWRVMLGRRDSKAADFDGAQNLPDPKESLKDLKKKFADVGLDDTDFVALQGAHTIGRAQCQSIQDRLYNFSSTEQPDPTLDHGYLAALRQRxxxxxxxxDGTALNDLDPATPDTFDNSYYANIQCNRGLLRSDQAMLSAPEEGAESTAPIVGRFAHSQAEFFQSFATAMIKMGNIAPLTGSMGEVRRDCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (undetermined residues due to NNNN in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGTCCGGCGATGCTGCCAGCGGCAGCCGTAGCCCTGTGCGCGGCGGTGCTGGCCCTAGCGGCGCTCGACGGCGGCGTGCGGGCGCAGCAGCTGAGCCCGGGGTACTACGACGAC
TCGTGCCCGCACGTATACGACACGGTGCGGCGCGTGATCCAGGAGGCGCGCACCGGCGACCCGCGCATCCTCGCCAGCCTCCTCCGCCTCCACTTTCACGACTGCTTCGCCAGC
GTACGT
GCACGCTTCGCGCAGCGCAACCCCGGCGCCTGCCGCTGCCGCTTCATGTCATGCAATCCGGGTCTAATCTGAGTGCTCGATTACTGGTCGTGTGCAGGGCTGTGACGGGTCGCTGCTGCT
CGACGAGACCCTGACGATGCGCAGCGAGAAGGCAGCCGACCCGAACAACGGCTCGGTGCGGGGGTTTCCCGTGGTGAACGACATCAAGGCCGCCCTGGAGGACGCTTGCCCCGGCGTCGT
CTCCTGCGCCGACATCCTCGCCCTCGCCGCCGAGGTCTCCGTTGAGCTG
GTCAGTTCCCTGATGACATGACGTAAACGATGCCCGCGTAAAAGTTACTGGCGGGGGTTACAGAGCGCAAC
TGCTGTTAGGAATTTCTAACGCATGCAATTTTCTGATCGGACGAGCAGGCAGGAGGTCCGTACTGGAGGGTGATGCTGGGCCGGAGGGACAGCAAGGCAGCCGACTTCGACGGCGCCCAA
AACCTCCCGGACCCCAAGGAATCGTTGAAAGACCTTAAGAAGAAGTTCGCCGACGTCGGCCTCGACGACACCGATTTCGTCGCGCTCCAAG
GTATTTTTAGCACAGGGGAACACGATAGC
ATATGCGCCGTCGTAACAGCAACCTCGCCGCGCGCGGCACGTAGCCGTGGCGTGCTGAACTCAGAAAATGACGTGCCCTCGTTGCACCTCGCAGGAGCGCACACGATCGGGCGCGCGCAG
TGCCAGTCCATCCAGGACAGGCTCTACAACTTCAGCAGCACGGAGCAGCCGGACCCAACGCTGGACCATGGGTACCTCGCCGCGCTCCGGCAACGCTNNNNNNNNNNNNNNNNNNNNNAC
GACGGCACGGCGCTGAACGACCTCGACCCGGCCACGCCGGACACGTTCGACAACAGCTACTACGCCAACATCCAGTGCAACCGCGGCCTACTCAGGTCCGACCAGGCGATGCTCTCCGCG
CCGGAGGAGGGCGCGGAATCCACCGCGCCCATCGTCGGGCGCTTCGCCCACAGCCAGGCCGAGTTCTTCCAGAGCTTCGCGACGGCCATGATCAAGATGGGGAACATTGCGCCGCTGACA
GGGAGCATGGGGGAGGTCAGGAGGGACTGCAGGGTGGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGTCCGGCGATGCTGCCAGCGGCAGCCGTAGCCCTGTGCGCGGCGGTGCTGGCCCTAGCGGCGCTCGACGGCGGCGTGCGGGCGCAGCAGCTGAGCCCGGGGTACTACGACGAC
TCGTGCCCGCACGTATACGACACGGTGCGGCGCGTGATCCAGGAGGCGCGCACCGGCGACCCGCGCATCCTCGCCAGCCTCCTCCGCCTCCACTTTCACGACTGCTTCGCCAGC
GGCTGT
GACGGGTCGCTGCTGCTCGACGAGACCCTGACGATGCGCAGCGAGAAGGCAGCCGACCCGAACAACGGCTCGGTGCGGGGGTTTCCCGTGGTGAACGACATCAAGGCCGCCCTGGAGGAC
GCTTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCGAGGTCTCCGTTGAGCTG
GCAGGAGGTCCGTACTGGAGGGTGATGCTGGGCCGGAGGGACAGCAAGGCAGCC
GACTTCGACGGCGCCCAAAACCTCCCGGACCCCAAGGAATCGTTGAAAGACCTTAAGAAGAAGTTCGCCGACGTCGGCCTCGACGACACCGATTTCGTCGCGCTCCAAG
GAGCGCACACG
ATCGGGCGCGCGCAGTGCCAGTCCATCCAGGACAGGCTCTACAACTTCAGCAGCACGGAGCAGCCGGACCCAACGCTGGACCATGGGTACCTCGCCGCGCTCCGGCAACGCTNNNNNNNN
NNNNNNNNNNNNNACGACGGCACGGCGCTGAACGACCTCGACCCGGCCACGCCGGACACGTTCGACAACAGCTACTACGCCAACATCCAGTGCAACCGCGGCCTACTCAGGTCCGACCAG
GCGATGCTCTCCGCGCCGGAGGAGGGCGCGGAATCCACCGCGCCCATCGTCGGGCGCTTCGCCCACAGCCAGGCCGAGTTCTTCCAGAGCTTCGCGACGGCCATGATCAAGATGGGGAAC
ATTGCGCCGCTGACAGGGAGCATGGGGGAGGTCAGGAGGGACTGCAGGGTGGTGAACTGA

Retrieve as FASTA