Entry information : SiPrx152 (Si036496m)
Entry ID 9495
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx152 (Si036496m)
Name (synonym) SiPrx152 (Si036496m)
Class Class III peroxidase    [Orthogroup: Prx069]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx152
start..stop
S start..stop
ZmPrx34 587 0 21..336 22..337
SiPrx149 568 0 3..336 2..342
SiPrx147 538 0 25..336 25..341
OsPrx125 535 0 32..336 32..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34319949..34320182 234 N° 2 34320304..34320495 192 N° 3 34321133..34321295 163 N° 4 34321389..34321813 425
join(34319949..34320182,34320304..34320495,34321133..34321295,34321389..34321813 )


exon

Literature and cross-references SiPrx152 (Si036496m)
DNA ref. Phytozome 12:   scaffold_9 (34319949..34321813)
Protein sequence: SiPrx152 (Si036496m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (307)
PWM (Da):   %s   36034.49 (33014.9) Transmb domain:   %s   i12-31o
PI (pH):   %s   4.27 (4.17) Peptide Signal:   %s   cut: 32 range:32-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSSAPRAAAVVAGVLVVMAALCLHGATAQLCEEYYDDTCPNAYDTVKQVLIDAHDSDTRIFASLIRLHFHDCFVQGCDGSLLLDTVPGMQSEKESPPNNASARGFEVVDAAKAALEAACPGVVSCADILAIAAEISVELSGGPSWGVLLGRLDGKTSDFNGSLDLPAPTDNLTVLQQKFSNLSLNDVDLVALSGGHTFGRVQCQFVTDRLYNFSGTNMPDPTLDSAYRAFLSQRCPRNGNGSVLNDLDPTTPDTFDNNYYTNIEVNRGILNSDQELKSSPQAQGTTAPIVDQFASSQDAFFASFAQSMINMGNIRPLTDPSVGEVRTNCRRVNGR*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCCTCTGCTCCTCGTGCAGCCGCCGTCGTCGCCGGCGTGCTGGTGGTGATGGCCGCCCTGTGCCTCCACGGCGCAACGGCGCAGCTGTGCGAGGAGTACTACGACGAC
ACGTGCCCCAACGCCTACGACACCGTGAAGCAGGTGCTCATCGACGCGCACGACTCGGACACCCGCATCTTCGCCAGCCTCATCCGCCTCCACTTCCACGACTGCTTTGTCCAG
GTAACT
ACCTTCCTTCCTCTCTCTGCTATGCCGCCATGCCCGTGTGCTCATGCATGGACATCAGCGTCTCGGATTCACGACGCATTTTCTTTGCTGACGAACCGTGTTAAATTGTTACTAGGGCTG
CGACGGGTCGCTGCTGCTGGACACAGTCCCCGGGATGCAGTCGGAGAAGGAGTCGCCGCCCAACAACGCCTCGGCGCGCGGGTTCGAGGTCGTGGACGCCGCCAAGGCGGCGCTGGAGGC
CGCCTGCCCCGGTGTCGTCTCCTGCGCCGACATCCTCGCCATCGCCGCAGAGATCTCCGTCGAGCTG
GTACGTCCTACTACTGCACAGAATATTTGTGATCAACGTATAGTAGGGTGGTA
GGTGCAACGTCGCAGTGAACGTACGGGCAGGCATCTCGATTGATGATCATCTGTCAATAACATGCATGCCATAATAGCTTCATCGATTACCATCGTACGTCTTGTTTCGAAGGAACGATT
TGATGGACGTGTCGGTGCGTGCATGTAAAGTACAATTTTATTCGTATTTGTAGTTATCATGCTAGATGCTACAGCTTAAGTGCTAATGTAGTTTCTTACGTATACACTTGTAAAGTACGA
CTTTACACGTACACTTGTAGCCATCAAACTAGATGATAAAGCTTAAGTGCTATACGGTAGCAAGGTTCTTGTTTGGTTATTTTTTTGCGTATACTTGTAGCTACCAAACTACATAACAAA
CCATGATTAATGGACAATCAGTCTGCTGATTGTTTGGTTATTTTTACTAGCTATTCTGATAAACTAATTAGAACGTGAAAAGTTTTGGCAAAGAATCTACGTAGAACAGCGAGGGCACAT
ATGACTTACGATTCACATGCATGATCGCAAAACGACGATGAACACGGATCGGTTGGTAAACTTAGCAAACATAATAATGCACACGCCCATGCCATCACATGCAGTCAGGAGGACCCAGTT
GGGGTGTCCTTCTGGGAAGGCTGGACGGCAAGACCTCCGACTTCAACGGGTCCCTGGATCTTCCGGCGCCCACCGACAACCTCACCGTACTTCAGCAGAAGTTCAGTAACCTCAGCCTCA
ACGACGTCGACCTTGTCGCCCTCTCAG
GTACAGATAATTCACCTCTCTGCAGCATACGTTTATCATCTTCGATACTGTTACCTTAACCTGAGCTGATAAACTAGTCTCTCTTGACCACAG

GGGGGCACACGTTCGGCCGGGTACAATGCCAGTTCGTCACGGACCGGCTCTACAACTTCAGCGGCACCAACATGCCGGACCCGACCCTGGACTCGGCTTACCGAGCGTTCCTATCGCAGA
GGTGCCCGAGGAATGGCAACGGTTCGGTCTTGAACGACCTCGACCCGACGACACCGGACACCTTCGACAACAACTACTACACCAACATCGAGGTGAACCGGGGTATCCTCAACTCCGACC
AGGAGCTCAAGTCGTCGCCCCAGGCGCAGGGCACCACGGCACCCATCGTCGACCAGTTTGCGAGCAGCCAGGACGCCTTCTTTGCGAGCTTTGCACAGTCCATGATCAACATGGGGAACA
TTAGGCCCCTGACGGACCCATCCGTAGGTGAGGTCCGTACCAACTGCAGAAGAGTCAATGGAAGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCCTCTGCTCCTCGTGCAGCCGCCGTCGTCGCCGGCGTGCTGGTGGTGATGGCCGCCCTGTGCCTCCACGGCGCAACGGCGCAGCTGTGCGAGGAGTACTACGACGAC
ACGTGCCCCAACGCCTACGACACCGTGAAGCAGGTGCTCATCGACGCGCACGACTCGGACACCCGCATCTTCGCCAGCCTCATCCGCCTCCACTTCCACGACTGCTTTGTCCAG
GGCTGC
GACGGGTCGCTGCTGCTGGACACAGTCCCCGGGATGCAGTCGGAGAAGGAGTCGCCGCCCAACAACGCCTCGGCGCGCGGGTTCGAGGTCGTGGACGCCGCCAAGGCGGCGCTGGAGGCC
GCCTGCCCCGGTGTCGTCTCCTGCGCCGACATCCTCGCCATCGCCGCAGAGATCTCCGTCGAGCTG
TCAGGAGGACCCAGTTGGGGTGTCCTTCTGGGAAGGCTGGACGGCAAGACCTCC
GACTTCAACGGGTCCCTGGATCTTCCGGCGCCCACCGACAACCTCACCGTACTTCAGCAGAAGTTCAGTAACCTCAGCCTCAACGACGTCGACCTTGTCGCCCTCTCAG
GGGGGCACACG
TTCGGCCGGGTACAATGCCAGTTCGTCACGGACCGGCTCTACAACTTCAGCGGCACCAACATGCCGGACCCGACCCTGGACTCGGCTTACCGAGCGTTCCTATCGCAGAGGTGCCCGAGG
AATGGCAACGGTTCGGTCTTGAACGACCTCGACCCGACGACACCGGACACCTTCGACAACAACTACTACACCAACATCGAGGTGAACCGGGGTATCCTCAACTCCGACCAGGAGCTCAAG
TCGTCGCCCCAGGCGCAGGGCACCACGGCACCCATCGTCGACCAGTTTGCGAGCAGCCAGGACGCCTTCTTTGCGAGCTTTGCACAGTCCATGATCAACATGGGGAACATTAGGCCCCTG
ACGGACCCATCCGTAGGTGAGGTCCGTACCAACTGCAGAAGAGTCAATGGAAGA

Retrieve as FASTA